Anti ARFIP1 pAb (ATL-HPA037375)

Atlas Antibodies

SKU:
ATL-HPA037375-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic and nuclear positivity in cells in tubules.
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleus, the Golgi apparatus & vesicles.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ADP-ribosylation factor interacting protein 1
Gene Name: ARFIP1
Alternative Gene Name: HSU52521
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074513: 85%, ENSRNOG00000010533: 84%
Entrez Gene ID: 27236
Uniprot ID: P53367
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ITSHGFDNTKEGVIEAGAFQGSPAPPLPSVMSPSRVAASRLAQQGSDLIVPAGGQRTQTKSGPVILADEIKNPAMEKLELVRKWSLNTY
Gene Sequence ITSHGFDNTKEGVIEAGAFQGSPAPPLPSVMSPSRVAASRLAQQGSDLIVPAGGQRTQTKSGPVILADEIKNPAMEKLELVRKWSLNTY
Gene ID - Mouse ENSMUSG00000074513
Gene ID - Rat ENSRNOG00000010533
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ARFIP1 pAb (ATL-HPA037375)
Datasheet Anti ARFIP1 pAb (ATL-HPA037375) Datasheet (External Link)
Vendor Page Anti ARFIP1 pAb (ATL-HPA037375) at Atlas Antibodies

Documents & Links for Anti ARFIP1 pAb (ATL-HPA037375)
Datasheet Anti ARFIP1 pAb (ATL-HPA037375) Datasheet (External Link)
Vendor Page Anti ARFIP1 pAb (ATL-HPA037375)