Anti ARFGEF3 pAb (ATL-HPA036350)

Atlas Antibodies

SKU:
ATL-HPA036350-25
  • Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in chief cells.
  • Western blot analysis in human cell line SK-BR-3.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ARFGEF family member 3
Gene Name: ARFGEF3
Alternative Gene Name: BIG3, C6orf92, dJ171N11.1, KIAA1244, PPP1R33
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019852: 96%, ENSRNOG00000011460: 95%
Entrez Gene ID: 57221
Uniprot ID: Q5TH69
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLKLLKNQEADQHSARLFIQSLEGLLPRLLSLSNVEEVDTALQNFASTFCSGMMHSPGFDGNSSLSFQMLMNADSLYTAAHCALLLNLKLSHG
Gene Sequence SLKLLKNQEADQHSARLFIQSLEGLLPRLLSLSNVEEVDTALQNFASTFCSGMMHSPGFDGNSSLSFQMLMNADSLYTAAHCALLLNLKLSHG
Gene ID - Mouse ENSMUSG00000019852
Gene ID - Rat ENSRNOG00000011460
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ARFGEF3 pAb (ATL-HPA036350)
Datasheet Anti ARFGEF3 pAb (ATL-HPA036350) Datasheet (External Link)
Vendor Page Anti ARFGEF3 pAb (ATL-HPA036350) at Atlas Antibodies

Documents & Links for Anti ARFGEF3 pAb (ATL-HPA036350)
Datasheet Anti ARFGEF3 pAb (ATL-HPA036350) Datasheet (External Link)
Vendor Page Anti ARFGEF3 pAb (ATL-HPA036350)