Anti ARFGEF2 pAb (ATL-HPA026078 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA026078-100

• 
• 

Protein Description: ADP-ribosylation factor guanine nucleotide-exchange factor 2 (brefeldin A-inhibited)
Gene Name: ARFGEF2
Alternative Gene Name: BIG2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074582: 78%, ENSRNOG00000007485: 74%
Entrez Gene ID: 10564
Uniprot ID: Q9Y6D5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KPIQSKPQSPVIQAAAVSPKFVRLKHSQAQSKPTTPEKTDLTNGEHARSDSGKVSTENGDAPRERGSSLSGTDDGAQEVVKDILEDVVTSAIKAAEKHGLTEPERVLGELECQECAIPPGVDENSQTNGI
• Gene Sequence: KPIQSKPQSPVIQAAAVSPKFVRLKHSQAQSKPTTPEKTDLTNGEHARSDSGKVSTENGDAPRERGSSLSGTDDGAQEVVKDILEDVVTSAIKAAEKHGLTEPERVLGELECQECAIPPGVDENSQTNGI
• Gene ID - Mouse: ENSMUSG00000074582
• Gene ID - Rat: ENSRNOG00000007485
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ARFGEF2 pAb (ATL-HPA026078 w/enhanced validation) – 1 Found

Christis, Chantal; Munro, Sean. The small G protein Arl1 directs the trans-Golgi-specific targeting of the Arf1 exchange factors BIG1 and BIG2. The Journal Of Cell Biology. 2012;196(3):327-35.