Anti ARFGEF1 pAb (ATL-HPA023822)
Atlas Antibodies
- Catalog No.:
- ATL-HPA023822-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: ARFGEF1
Alternative Gene Name: ARFGEP1, BIG1, DKFZP434L057, p200
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000067851: 90%, ENSRNOG00000005703: 90%
Entrez Gene ID: 10565
Uniprot ID: Q9Y6D6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human, Mouse |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QALQEAKQMEKERHRQHHHLLQSPVSHHEPESPQLRYLPPQTVDHISQEHEGDLDLHTNDVDKSLQDDTEPENGSDISSAENEQTEA |
Gene Sequence | QALQEAKQMEKERHRQHHHLLQSPVSHHEPESPQLRYLPPQTVDHISQEHEGDLDLHTNDVDKSLQDDTEPENGSDISSAENEQTEA |
Gene ID - Mouse | ENSMUSG00000067851 |
Gene ID - Rat | ENSRNOG00000005703 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ARFGEF1 pAb (ATL-HPA023822) | |
Datasheet | Anti ARFGEF1 pAb (ATL-HPA023822) Datasheet (External Link) |
Vendor Page | Anti ARFGEF1 pAb (ATL-HPA023822) at Atlas Antibodies |
Documents & Links for Anti ARFGEF1 pAb (ATL-HPA023822) | |
Datasheet | Anti ARFGEF1 pAb (ATL-HPA023822) Datasheet (External Link) |
Vendor Page | Anti ARFGEF1 pAb (ATL-HPA023822) |
Citations for Anti ARFGEF1 pAb (ATL-HPA023822) – 1 Found |
Miyamoto, Yuki; Torii, Tomohiro; Tago, Kenji; Tanoue, Akito; Takashima, Shou; Yamauchi, Junji. BIG1/Arfgef1 and Arf1 regulate the initiation of myelination by Schwann cells in mice. Science Advances. 2018;4(4):eaar4471. PubMed |