Anti ARFGEF1 pAb (ATL-HPA023822)

Atlas Antibodies

Catalog No.: ATL-HPA023822-100

Protein Description: ADP-ribosylation factor guanine nucleotide-exchange factor 1 (brefeldin A-inhibited)
Gene Name: ARFGEF1
Alternative Gene Name: ARFGEP1, BIG1, DKFZP434L057, p200
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000067851: 90%, ENSRNOG00000005703: 90%
Entrez Gene ID: 10565
Uniprot ID: Q9Y6D6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QALQEAKQMEKERHRQHHHLLQSPVSHHEPESPQLRYLPPQTVDHISQEHEGDLDLHTNDVDKSLQDDTEPENGSDISSAENEQTEA
• Gene Sequence: QALQEAKQMEKERHRQHHHLLQSPVSHHEPESPQLRYLPPQTVDHISQEHEGDLDLHTNDVDKSLQDDTEPENGSDISSAENEQTEA
• Gene ID - Mouse: ENSMUSG00000067851
• Gene ID - Rat: ENSRNOG00000005703
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ARFGEF1 pAb (ATL-HPA023822) – 1 Found

Miyamoto, Yuki; Torii, Tomohiro; Tago, Kenji; Tanoue, Akito; Takashima, Shou; Yamauchi, Junji. BIG1/Arfgef1 and Arf1 regulate the initiation of myelination by Schwann cells in mice. Science Advances. 2018;4(4):eaar4471.