Anti ARFGEF1 pAb (ATL-HPA023399)

Atlas Antibodies

SKU: ATL-HPA023399-25

• 
• 

Protein Description: ADP-ribosylation factor guanine nucleotide-exchange factor 1 (brefeldin A-inhibited)
Gene Name: ARFGEF1
Alternative Gene Name: ARFGEP1, BIG1, DKFZP434L057, p200
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000067851: 86%, ENSRNOG00000005703: 86%
Entrez Gene ID: 10565
Uniprot ID: Q9Y6D6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VLYDGENHDCEEKPQDIVQNIVEEMVNIVVGDMGEGTTINASADGNIGTIEDGSDSENIQANGIPGTPISVAYTPSLPDDRLSVSSNDTQESGNSSGPSPGAKF
• Gene Sequence: VLYDGENHDCEEKPQDIVQNIVEEMVNIVVGDMGEGTTINASADGNIGTIEDGSDSENIQANGIPGTPISVAYTPSLPDDRLSVSSNDTQESGNSSGPSPGAKF
• Gene ID - Mouse: ENSMUSG00000067851
• Gene ID - Rat: ENSRNOG00000005703
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ARFGEF1 pAb (ATL-HPA023399) – 1 Found

Christis, Chantal; Munro, Sean. The small G protein Arl1 directs the trans-Golgi-specific targeting of the Arf1 exchange factors BIG1 and BIG2. The Journal Of Cell Biology. 2012;196(3):327-35.