Anti ARFGEF1 pAb (ATL-HPA023399)

Atlas Antibodies

Catalog No.:
ATL-HPA023399-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ADP-ribosylation factor guanine nucleotide-exchange factor 1 (brefeldin A-inhibited)
Gene Name: ARFGEF1
Alternative Gene Name: ARFGEP1, BIG1, DKFZP434L057, p200
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000067851: 86%, ENSRNOG00000005703: 86%
Entrez Gene ID: 10565
Uniprot ID: Q9Y6D6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VLYDGENHDCEEKPQDIVQNIVEEMVNIVVGDMGEGTTINASADGNIGTIEDGSDSENIQANGIPGTPISVAYTPSLPDDRLSVSSNDTQESGNSSGPSPGAKF
Gene Sequence VLYDGENHDCEEKPQDIVQNIVEEMVNIVVGDMGEGTTINASADGNIGTIEDGSDSENIQANGIPGTPISVAYTPSLPDDRLSVSSNDTQESGNSSGPSPGAKF
Gene ID - Mouse ENSMUSG00000067851
Gene ID - Rat ENSRNOG00000005703
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARFGEF1 pAb (ATL-HPA023399)
Datasheet Anti ARFGEF1 pAb (ATL-HPA023399) Datasheet (External Link)
Vendor Page Anti ARFGEF1 pAb (ATL-HPA023399) at Atlas Antibodies

Documents & Links for Anti ARFGEF1 pAb (ATL-HPA023399)
Datasheet Anti ARFGEF1 pAb (ATL-HPA023399) Datasheet (External Link)
Vendor Page Anti ARFGEF1 pAb (ATL-HPA023399)
Citations for Anti ARFGEF1 pAb (ATL-HPA023399) – 1 Found
Christis, Chantal; Munro, Sean. The small G protein Arl1 directs the trans-Golgi-specific targeting of the Arf1 exchange factors BIG1 and BIG2. The Journal Of Cell Biology. 2012;196(3):327-35.  PubMed