Anti ARFGEF1 pAb (ATL-HPA023399)
Atlas Antibodies
- Catalog No.:
- ATL-HPA023399-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ARFGEF1
Alternative Gene Name: ARFGEP1, BIG1, DKFZP434L057, p200
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000067851: 86%, ENSRNOG00000005703: 86%
Entrez Gene ID: 10565
Uniprot ID: Q9Y6D6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VLYDGENHDCEEKPQDIVQNIVEEMVNIVVGDMGEGTTINASADGNIGTIEDGSDSENIQANGIPGTPISVAYTPSLPDDRLSVSSNDTQESGNSSGPSPGAKF |
Gene Sequence | VLYDGENHDCEEKPQDIVQNIVEEMVNIVVGDMGEGTTINASADGNIGTIEDGSDSENIQANGIPGTPISVAYTPSLPDDRLSVSSNDTQESGNSSGPSPGAKF |
Gene ID - Mouse | ENSMUSG00000067851 |
Gene ID - Rat | ENSRNOG00000005703 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ARFGEF1 pAb (ATL-HPA023399) | |
Datasheet | Anti ARFGEF1 pAb (ATL-HPA023399) Datasheet (External Link) |
Vendor Page | Anti ARFGEF1 pAb (ATL-HPA023399) at Atlas Antibodies |
Documents & Links for Anti ARFGEF1 pAb (ATL-HPA023399) | |
Datasheet | Anti ARFGEF1 pAb (ATL-HPA023399) Datasheet (External Link) |
Vendor Page | Anti ARFGEF1 pAb (ATL-HPA023399) |
Citations for Anti ARFGEF1 pAb (ATL-HPA023399) – 1 Found |
Christis, Chantal; Munro, Sean. The small G protein Arl1 directs the trans-Golgi-specific targeting of the Arf1 exchange factors BIG1 and BIG2. The Journal Of Cell Biology. 2012;196(3):327-35. PubMed |