Anti AREG pAb (ATL-HPA008720)

Atlas Antibodies

SKU: ATL-HPA008720-25

• 

Protein Description: amphiregulin
Gene Name: AREG
Alternative Gene Name: AREGB, SDGF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029378: 73%, ENSRNOG00000002754: 73%
Entrez Gene ID: 374
Uniprot ID: P15514
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FSGDHSADGFEVTSRSEMSSGSEISPVSEMPSSSEPSSGADYDYSEEYDNEPQIPGYIVDDSVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERC
• Gene Sequence: FSGDHSADGFEVTSRSEMSSGSEISPVSEMPSSSEPSSGADYDYSEEYDNEPQIPGYIVDDSVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERC
• Gene ID - Mouse: ENSMUSG00000029378
• Gene ID - Rat: ENSRNOG00000002754
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti AREG pAb (ATL-HPA008720) – 3 Found

Barton, Valerie N; D'Amato, Nicholas C; Gordon, Michael A; Lind, Hanne T; Spoelstra, Nicole S; Babbs, Beatrice L; Heinz, Richard E; Elias, Anthony; Jedlicka, Paul; Jacobsen, Britta M; Richer, Jennifer K. Multiple molecular subtypes of triple-negative breast cancer critically rely on androgen receptor and respond to enzalutamide in vivo. Molecular Cancer Therapeutics. 2015;14(3):769-78. 

Alamri, Ahmad M; Liu, Xuefeng; Blancato, Jan K; Haddad, Bassem R; Wang, Weisheng; Zhong, Xiaogang; Choudhary, Sujata; Krawczyk, Ewa; Kallakury, Bhaskar V; Davidson, Bruce J; Furth, Priscilla A. Expanding primary cells from mucoepidermoid and other salivary gland neoplasms for genetic and chemosensitivity testing. Disease Models & Mechanisms. 2018;11(1) 

Melderis, Simon; Hagenstein, Julia; Warkotsch, Matthias Tobias; Dang, Julien; Herrnstadt, Georg Rudolf; Niehus, Christoph Benjamin; Neumann, Katrin; Panzer, Ulf; Berasain, Carmen; Avila, Matias A; Tharaux, Pierre-Louis; Tiegs, Gisa; Steinmetz, Oliver M. Amphiregulin Aggravates Glomerulonephritis via Recruitment and Activation of Myeloid Cells. Journal Of The American Society Of Nephrology : Jasn. 2020;31(9):1996-2012.