Anti ARCN1 pAb (ATL-HPA044874)

Atlas Antibodies

Catalog No.:
ATL-HPA044874-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: archain 1
Gene Name: ARCN1
Alternative Gene Name: COPD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032096: 97%, ENSRNOG00000061108: 96%
Entrez Gene ID: 372
Uniprot ID: P48444
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KSEGETIMSSSMGKRTSEATKMHAPPINMESVHMKIEEKITLTCGRDGGLQNMELHGMIMLRISDDKYGRIRLHVENEDKKGVQLQTHPN
Gene Sequence KSEGETIMSSSMGKRTSEATKMHAPPINMESVHMKIEEKITLTCGRDGGLQNMELHGMIMLRISDDKYGRIRLHVENEDKKGVQLQTHPN
Gene ID - Mouse ENSMUSG00000032096
Gene ID - Rat ENSRNOG00000061108
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARCN1 pAb (ATL-HPA044874)
Datasheet Anti ARCN1 pAb (ATL-HPA044874) Datasheet (External Link)
Vendor Page Anti ARCN1 pAb (ATL-HPA044874) at Atlas Antibodies

Documents & Links for Anti ARCN1 pAb (ATL-HPA044874)
Datasheet Anti ARCN1 pAb (ATL-HPA044874) Datasheet (External Link)
Vendor Page Anti ARCN1 pAb (ATL-HPA044874)