Anti ARC pAb (ATL-HPA056430)

Atlas Antibodies

SKU:
ATL-HPA056430-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to microtubules & vesicles.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: activity-regulated cytoskeleton-associated protein
Gene Name: ARC
Alternative Gene Name: Arg3.1, KIAA0278
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022602: 90%, ENSRNOG00000043465: 90%
Entrez Gene ID: 23237
Uniprot ID: Q7LC44
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ESTGGKYPVGSESARHTVSVGVGGPESYCHEADGYDYTVSPYAITPPPAAGELPGQEPAEAQQYQPWVPGEDGQPSPGVDTQIFEDPREFLS
Gene Sequence ESTGGKYPVGSESARHTVSVGVGGPESYCHEADGYDYTVSPYAITPPPAAGELPGQEPAEAQQYQPWVPGEDGQPSPGVDTQIFEDPREFLS
Gene ID - Mouse ENSMUSG00000022602
Gene ID - Rat ENSRNOG00000043465
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ARC pAb (ATL-HPA056430)
Datasheet Anti ARC pAb (ATL-HPA056430) Datasheet (External Link)
Vendor Page Anti ARC pAb (ATL-HPA056430) at Atlas Antibodies

Documents & Links for Anti ARC pAb (ATL-HPA056430)
Datasheet Anti ARC pAb (ATL-HPA056430) Datasheet (External Link)
Vendor Page Anti ARC pAb (ATL-HPA056430)