Anti ARC pAb (ATL-HPA056430)
Atlas Antibodies
- Catalog No.:
- ATL-HPA056430-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ARC
Alternative Gene Name: Arg3.1, KIAA0278
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022602: 90%, ENSRNOG00000043465: 90%
Entrez Gene ID: 23237
Uniprot ID: Q7LC44
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ESTGGKYPVGSESARHTVSVGVGGPESYCHEADGYDYTVSPYAITPPPAAGELPGQEPAEAQQYQPWVPGEDGQPSPGVDTQIFEDPREFLS |
Gene Sequence | ESTGGKYPVGSESARHTVSVGVGGPESYCHEADGYDYTVSPYAITPPPAAGELPGQEPAEAQQYQPWVPGEDGQPSPGVDTQIFEDPREFLS |
Gene ID - Mouse | ENSMUSG00000022602 |
Gene ID - Rat | ENSRNOG00000043465 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ARC pAb (ATL-HPA056430) | |
Datasheet | Anti ARC pAb (ATL-HPA056430) Datasheet (External Link) |
Vendor Page | Anti ARC pAb (ATL-HPA056430) at Atlas Antibodies |
Documents & Links for Anti ARC pAb (ATL-HPA056430) | |
Datasheet | Anti ARC pAb (ATL-HPA056430) Datasheet (External Link) |
Vendor Page | Anti ARC pAb (ATL-HPA056430) |