Anti ARAP2 pAb (ATL-HPA035925)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035925-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ARAP2
Alternative Gene Name: CENTD1, PARX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037999: 79%, ENSRNOG00000056826: 78%
Entrez Gene ID: 116984
Uniprot ID: Q8WZ64
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HCLEHKDDKLRNRPRKHRSFNCLEDTEPEAPLGQPKGHKGLKTLRKTEDRNSKATLDSDHKLPSRVIEELNVVLQRSRTLPKELQDEQI |
| Gene Sequence | HCLEHKDDKLRNRPRKHRSFNCLEDTEPEAPLGQPKGHKGLKTLRKTEDRNSKATLDSDHKLPSRVIEELNVVLQRSRTLPKELQDEQI |
| Gene ID - Mouse | ENSMUSG00000037999 |
| Gene ID - Rat | ENSRNOG00000056826 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ARAP2 pAb (ATL-HPA035925) | |
| Datasheet | Anti ARAP2 pAb (ATL-HPA035925) Datasheet (External Link) |
| Vendor Page | Anti ARAP2 pAb (ATL-HPA035925) at Atlas Antibodies |
| Documents & Links for Anti ARAP2 pAb (ATL-HPA035925) | |
| Datasheet | Anti ARAP2 pAb (ATL-HPA035925) Datasheet (External Link) |
| Vendor Page | Anti ARAP2 pAb (ATL-HPA035925) |