Anti ARAP2 pAb (ATL-HPA035925)

Atlas Antibodies

Catalog No.:
ATL-HPA035925-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 2
Gene Name: ARAP2
Alternative Gene Name: CENTD1, PARX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037999: 79%, ENSRNOG00000056826: 78%
Entrez Gene ID: 116984
Uniprot ID: Q8WZ64
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HCLEHKDDKLRNRPRKHRSFNCLEDTEPEAPLGQPKGHKGLKTLRKTEDRNSKATLDSDHKLPSRVIEELNVVLQRSRTLPKELQDEQI
Gene Sequence HCLEHKDDKLRNRPRKHRSFNCLEDTEPEAPLGQPKGHKGLKTLRKTEDRNSKATLDSDHKLPSRVIEELNVVLQRSRTLPKELQDEQI
Gene ID - Mouse ENSMUSG00000037999
Gene ID - Rat ENSRNOG00000056826
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARAP2 pAb (ATL-HPA035925)
Datasheet Anti ARAP2 pAb (ATL-HPA035925) Datasheet (External Link)
Vendor Page Anti ARAP2 pAb (ATL-HPA035925) at Atlas Antibodies

Documents & Links for Anti ARAP2 pAb (ATL-HPA035925)
Datasheet Anti ARAP2 pAb (ATL-HPA035925) Datasheet (External Link)
Vendor Page Anti ARAP2 pAb (ATL-HPA035925)