Anti ARAP2 pAb (ATL-HPA035925)

Atlas Antibodies

Catalog No.: ATL-HPA035925-25

Protein Description: ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 2
Gene Name: ARAP2
Alternative Gene Name: CENTD1, PARX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037999: 79%, ENSRNOG00000056826: 78%
Entrez Gene ID: 116984
Uniprot ID: Q8WZ64
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HCLEHKDDKLRNRPRKHRSFNCLEDTEPEAPLGQPKGHKGLKTLRKTEDRNSKATLDSDHKLPSRVIEELNVVLQRSRTLPKELQDEQI
• Gene Sequence: HCLEHKDDKLRNRPRKHRSFNCLEDTEPEAPLGQPKGHKGLKTLRKTEDRNSKATLDSDHKLPSRVIEELNVVLQRSRTLPKELQDEQI
• Gene ID - Mouse: ENSMUSG00000037999
• Gene ID - Rat: ENSRNOG00000056826
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.