Anti ARAP1 pAb (ATL-HPA070383)
Atlas Antibodies
- Catalog No.:
- ATL-HPA070383-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ARAP1
Alternative Gene Name: CENTD2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032812: 80%, ENSRNOG00000019555: 82%
Entrez Gene ID: 116985
Uniprot ID: Q96P48
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SLPSTIAAPHPMDGPPGGSTPVTPVIKAGWLDKNPPQGSYIYQKRWVRLDTDHLRYFDSNKDAYSKRFISVACISHVAAIGDQKFEVITNNRTFAFRAESDVERK |
Gene Sequence | SLPSTIAAPHPMDGPPGGSTPVTPVIKAGWLDKNPPQGSYIYQKRWVRLDTDHLRYFDSNKDAYSKRFISVACISHVAAIGDQKFEVITNNRTFAFRAESDVERK |
Gene ID - Mouse | ENSMUSG00000032812 |
Gene ID - Rat | ENSRNOG00000019555 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ARAP1 pAb (ATL-HPA070383) | |
Datasheet | Anti ARAP1 pAb (ATL-HPA070383) Datasheet (External Link) |
Vendor Page | Anti ARAP1 pAb (ATL-HPA070383) at Atlas Antibodies |
Documents & Links for Anti ARAP1 pAb (ATL-HPA070383) | |
Datasheet | Anti ARAP1 pAb (ATL-HPA070383) Datasheet (External Link) |
Vendor Page | Anti ARAP1 pAb (ATL-HPA070383) |