Anti ARAP1 pAb (ATL-HPA070383)

Atlas Antibodies

SKU:
ATL-HPA070383-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
  • Immunofluorescent staining of human cell line HaCaT shows localization to nucleoplasm & plasma membrane.
  • Western blot analysis in human cell line RT-4.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 1
Gene Name: ARAP1
Alternative Gene Name: CENTD2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032812: 80%, ENSRNOG00000019555: 82%
Entrez Gene ID: 116985
Uniprot ID: Q96P48
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLPSTIAAPHPMDGPPGGSTPVTPVIKAGWLDKNPPQGSYIYQKRWVRLDTDHLRYFDSNKDAYSKRFISVACISHVAAIGDQKFEVITNNRTFAFRAESDVERK
Gene Sequence SLPSTIAAPHPMDGPPGGSTPVTPVIKAGWLDKNPPQGSYIYQKRWVRLDTDHLRYFDSNKDAYSKRFISVACISHVAAIGDQKFEVITNNRTFAFRAESDVERK
Gene ID - Mouse ENSMUSG00000032812
Gene ID - Rat ENSRNOG00000019555
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ARAP1 pAb (ATL-HPA070383)
Datasheet Anti ARAP1 pAb (ATL-HPA070383) Datasheet (External Link)
Vendor Page Anti ARAP1 pAb (ATL-HPA070383) at Atlas Antibodies

Documents & Links for Anti ARAP1 pAb (ATL-HPA070383)
Datasheet Anti ARAP1 pAb (ATL-HPA070383) Datasheet (External Link)
Vendor Page Anti ARAP1 pAb (ATL-HPA070383)