Anti ARAF pAb (ATL-HPA066326 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA066326-25

• 
• 

Protein Description: A-Raf proto-oncogene, serine/threonine kinase
Gene Name: ARAF
Alternative Gene Name: ARAF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001127: 83%, ENSRNOG00000010838: 81%
Entrez Gene ID: 369
Uniprot ID: P10398
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MSTNRQQFYHSVQDLSGGSRQHEAPSNRPLNELLTPQGPSPRTQHCDPEHFPFPAPANAPLQRIRSTST
• Gene Sequence: MSTNRQQFYHSVQDLSGGSRQHEAPSNRPLNELLTPQGPSPRTQHCDPEHFPFPAPANAPLQRIRSTST
• Gene ID - Mouse: ENSMUSG00000001127
• Gene ID - Rat: ENSRNOG00000010838
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.