Anti AR pAb (ATL-HPA065701)

Atlas Antibodies

Catalog No.: ATL-HPA065701-25

Protein Description: androgen receptor
Gene Name: AR
Alternative Gene Name: AIS, DHTR, HUMARA, NR3C4, SBMA, SMAX1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046532: 83%, ENSRNOG00000005639: 83%
Entrez Gene ID: 367
Uniprot ID: P10275
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LSPGEQLRGDCMYAPLLGVPPAVRPTPCAPLAECKGSLLDDSAGKSTEDTAEYSPFKGGYTKGLEG
• Gene Sequence: LSPGEQLRGDCMYAPLLGVPPAVRPTPCAPLAECKGSLLDDSAGKSTEDTAEYSPFKGGYTKGLEG
• Gene ID - Mouse: ENSMUSG00000046532
• Gene ID - Rat: ENSRNOG00000005639
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.