Anti AQP8 pAb (ATL-HPA046259 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA046259-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: aquaporin 8
Gene Name: AQP8
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030762: 39%, ENSRNOG00000049985: 35%
Entrez Gene ID: 343
Uniprot ID: O94778
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EIAMCEPEFGNDKAREPSVGGRWRVSWYERF
Gene Sequence EIAMCEPEFGNDKAREPSVGGRWRVSWYERF
Gene ID - Mouse ENSMUSG00000030762
Gene ID - Rat ENSRNOG00000049985
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AQP8 pAb (ATL-HPA046259 w/enhanced validation)
Datasheet Anti AQP8 pAb (ATL-HPA046259 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AQP8 pAb (ATL-HPA046259 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti AQP8 pAb (ATL-HPA046259 w/enhanced validation)
Datasheet Anti AQP8 pAb (ATL-HPA046259 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AQP8 pAb (ATL-HPA046259 w/enhanced validation)
Citations for Anti AQP8 pAb (ATL-HPA046259 w/enhanced validation) – 2 Found
Escudero-Hernández, Celia; Münch, Andreas; Østvik, Ann-Elisabet; Granlund, Atle van Beelen; Koch, Stefan. The Water Channel Aquaporin 8 is a Critical Regulator of Intestinal Fluid Homeostasis in Collagenous Colitis. Journal Of Crohn's & Colitis. 2020;14(7):962-973.  PubMed
Pellavio, Giorgia; Sommi, Patrizia; Anselmi-Tamburini, Umberto; DeMichelis, Maria Paola; Coniglio, Stefania; Laforenza, Umberto. Cerium Oxide Nanoparticles Regulate Oxidative Stress in HeLa Cells by Increasing the Aquaporin-Mediated Hydrogen Peroxide Permeability. International Journal Of Molecular Sciences. 2022;23(18)  PubMed