Anti AQP4 pAb (ATL-HPA014784 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA014784-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: AQP4
Alternative Gene Name: MIWC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024411: 93%, ENSRNOG00000016043: 92%
Entrez Gene ID: 361
Uniprot ID: P55087
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human, Mouse |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV |
Gene Sequence | CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV |
Gene ID - Mouse | ENSMUSG00000024411 |
Gene ID - Rat | ENSRNOG00000016043 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti AQP4 pAb (ATL-HPA014784 w/enhanced validation) | |
Datasheet | Anti AQP4 pAb (ATL-HPA014784 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti AQP4 pAb (ATL-HPA014784 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti AQP4 pAb (ATL-HPA014784 w/enhanced validation) | |
Datasheet | Anti AQP4 pAb (ATL-HPA014784 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti AQP4 pAb (ATL-HPA014784 w/enhanced validation) |
Citations for Anti AQP4 pAb (ATL-HPA014784 w/enhanced validation) – 25 Found |
Liddelow, Shane A; Guttenplan, Kevin A; Clarke, Laura E; Bennett, Frederick C; Bohlen, Christopher J; Schirmer, Lucas; Bennett, Mariko L; Münch, Alexandra E; Chung, Won-Suk; Peterson, Todd C; Wilton, Daniel K; Frouin, Arnaud; Napier, Brooke A; Panicker, Nikhil; Kumar, Manoj; Buckwalter, Marion S; Rowitch, David H; Dawson, Valina L; Dawson, Ted M; Stevens, Beth; Barres, Ben A. Neurotoxic reactive astrocytes are induced by activated microglia. Nature. 2017;541(7638):481-487. PubMed |
Chen, Jing; He, Wanwan; Hu, Xu; Shen, Yuwen; Cao, Junyan; Wei, Zhengdong; Luan, Yifei; He, Li; Jiang, Fangdun; Tao, Yanmei. A role for ErbB signaling in the induction of reactive astrogliosis. Cell Discovery. 3( 29238610):17044. PubMed |
Rosenberg, Shai; Simeonova, Iva; Bielle, Franck; Verreault, Maite; Bance, Bertille; Le Roux, Isabelle; Daniau, Mailys; Nadaradjane, Arun; Gleize, Vincent; Paris, Sophie; Marie, Yannick; Giry, Marine; Polivka, Marc; Figarella-Branger, Dominique; Aubriot-Lorton, Marie-Hélène; Villa, Chiara; Vasiljevic, Alexandre; Lechapt-Zalcman, Emmanuèle; Kalamarides, Michel; Sharif, Ariane; Mokhtari, Karima; Pagnotta, Stefano Maria; Iavarone, Antonio; Lasorella, Anna; Huillard, Emmanuelle; Sanson, Marc. A recurrent point mutation in PRKCA is a hallmark of chordoid gliomas. Nature Communications. 2018;9(1):2371. PubMed |
Cerrato, Valentina; Parmigiani, Elena; Figueres-Oñate, María; Betizeau, Marion; Aprato, Jessica; Nanavaty, Ishira; Berchialla, Paola; Luzzati, Federico; de'Sperati, Claudio; López-Mascaraque, Laura; Buffo, Annalisa. Multiple origins and modularity in the spatiotemporal emergence of cerebellar astrocyte heterogeneity. Plos Biology. 2018;16(9):e2005513. PubMed |
Li, Fengwu; Geng, Xiaokun; Yip, James; Ding, Yuchuan. Therapeutic Target and Cell-signal Communication of Chlorpromazine and Promethazine in Attenuating Blood-Brain Barrier Disruption after Ischemic Stroke. Cell Transplantation. 2019;28(2):145-156. PubMed |
Diéguez-Hurtado, Rodrigo; Kato, Katsuhiro; Giaimo, Benedetto Daniele; Nieminen-Kelhä, Melina; Arf, Hendrik; Ferrante, Francesca; Bartkuhn, Marek; Zimmermann, Tobias; Bixel, M Gabriele; Eilken, Hanna M; Adams, Susanne; Borggrefe, Tilman; Vajkoczy, Peter; Adams, Ralf H. Loss of the transcription factor RBPJ induces disease-promoting properties in brain pericytes. Nature Communications. 2019;10(1):2817. PubMed |
Barbar, Lilianne; Jain, Tanya; Zimmer, Matthew; Kruglikov, Ilya; Sadick, Jessica S; Wang, Minghui; Kalpana, Kriti; Rose, Indigo V L; Burstein, Suzanne R; Rusielewicz, Tomasz; Nijsure, Madhura; Guttenplan, Kevin A; di Domenico, Angelique; Croft, Gist; Zhang, Bin; Nobuta, Hiroko; Hébert, Jean M; Liddelow, Shane A; Fossati, Valentina. CD49f Is a Novel Marker of Functional and Reactive Human iPSC-Derived Astrocytes. Neuron. 2020;107(3):436-453.e12. PubMed |
Bergström, Sofia; Remnestål, Julia; Yousef, Jamil; Olofsson, Jennie; Markaki, Ioanna; Carvalho, Stephanie; Corvol, Jean-Christophe; Kultima, Kim; Kilander, Lena; Löwenmark, Malin; Ingelsson, Martin; Blennow, Kaj; Zetterberg, Henrik; Nellgård, Bengt; Brosseron, Frederic; Heneka, Michael T; Bosch, Beatriz; Sanchez-Valle, Raquel; Månberg, Anna; Svenningsson, Per; Nilsson, Peter. Multi-cohort profiling reveals elevated CSF levels of brain-enriched proteins in Alzheimer's disease. Annals Of Clinical And Translational Neurology. 2021;8(7):1456-1470. PubMed |
Bergström, Sofia; Öijerstedt, Linn; Remnestål, Julia; Olofsson, Jennie; Ullgren, Abbe; Seelaar, Harro; van Swieten, John C; Synofzik, Matthis; Sanchez-Valle, Raquel; Moreno, Fermin; Finger, Elizabeth; Masellis, Mario; Tartaglia, Carmela; Vandenberghe, Rik; Laforce, Robert; Galimberti, Daniela; Borroni, Barbara; Butler, Chris R; Gerhard, Alexander; Ducharme, Simon; Rohrer, Jonathan D; Månberg, Anna; Graff, Caroline; Nilsson, Peter. A panel of CSF proteins separates genetic frontotemporal dementia from presymptomatic mutation carriers: a GENFI study. Molecular Neurodegeneration. 2021;16(1):79. PubMed |
Xu, Tingting; Li, Xiaofei; Guo, Yuxi; Uhlin, Elias; Holmberg, Lena; Mitra, Sumonto; Winn, Dania; Falk, Anna; Sundström, Erik. Multiple therapeutic effects of human neural stem cells derived from induced pluripotent stem cells in a rat model of post-traumatic syringomyelia. Ebiomedicine. 2022;77( 35182996):103882. PubMed |
Pandit, Kunal; Petrescu, Joana; Cuevas, Miguel; Stephenson, William; Smibert, Peter; Phatnani, Hemali; Maniatis, Silas. An open source toolkit for repurposing Illumina sequencing systems as versatile fluidics and imaging platforms. Scientific Reports. 2022;12(1):5081. PubMed |
Rayaprolu, Sruti; Bitarafan, Sara; Santiago, Juliet V; Betarbet, Ranjita; Sunna, Sydney; Cheng, Lihong; Xiao, Hailian; Nelson, Ruth S; Kumar, Prateek; Bagchi, Pritha; Duong, Duc M; Goettemoeller, Annie M; Oláh, Viktor János; Rowan, Matt; Levey, Allan I; Wood, Levi B; Seyfried, Nicholas T; Rangaraju, Srikant. Cell type-specific biotin labeling in vivo resolves regional neuronal and astrocyte proteomic differences in mouse brain. Nature Communications. 2022;13(1):2927. PubMed |
Sareen, Dhruv; Gowing, Geneviève; Sahabian, Anais; Staggenborg, Kevin; Paradis, Renée; Avalos, Pablo; Latter, Jessica; Ornelas, Loren; Garcia, Leslie; Svendsen, Clive N. Human induced pluripotent stem cells are a novel source of neural progenitor cells (iNPCs) that migrate and integrate in the rodent spinal cord. The Journal Of Comparative Neurology. 2014;522(12):2707-28. PubMed |
Lopez-Rodriguez, Ana Belen; Acaz-Fonseca, Estefania; Viveros, Maria-Paz; Garcia-Segura, Luis M. Changes in cannabinoid receptors, aquaporin 4 and vimentin expression after traumatic brain injury in adolescent male mice. Association with edema and neurological deficit. Plos One. 10(6):e0128782. PubMed |
Vogel, Anna-Lena; Knier, Benjamin; Lammens, Katja; Kalluri, Sudhakar Reddy; Kuhlmann, Tanja; Bennett, Jeffrey L; Korn, Thomas. Deletional tolerance prevents AQP4-directed autoimmunity in mice. European Journal Of Immunology. 2017;47(3):458-469. PubMed |
Early, Alexandria N; Gorman, Amy A; Van Eldik, Linda J; Bachstetter, Adam D; Morganti, Josh M. Effects of advanced age upon astrocyte-specific responses to acute traumatic brain injury in mice. Journal Of Neuroinflammation. 2020;17(1):115. PubMed |
Paraiso, Hallel C; Wang, Xueqian; Kuo, Ping-Chang; Furnas, Destin; Scofield, Barbara A; Chang, Fen-Lei; Yen, Jui-Hung; Yu, I-Chen. Isolation of Mouse Cerebral Microvasculature for Molecular and Single-Cell Analysis. Frontiers In Cellular Neuroscience. 14( 32327974):84. PubMed |
Rao, Wei; Niroula, Suchan; Wang, Shan; Vincent, Matthew; McKeon, Frank; Xian, Wa. Protocol for Cloning Epithelial Stem Cell Variants from Human Lung. Star Protocols. 2020;1(2) PubMed |
Ghirotto, Bruno; Oliveira, Danyllo F; Cipelli, Marcella; Basso, Paulo J; de Lima, Jean; Breda, Cristiane N S; Ribeiro, Henrique C; Silva, Camille C C; Sertié, Andrea L; Oliveira, Antonio Edson R; Hiyane, Meire I; Caldini, Elia G; Sussulini, Alessandra; Nakaya, Helder I; Kowaltowski, Alicia J; Oliveira, Enedina M L; Zatz, Mayana; Câmara, Niels O S. MS-Driven Metabolic Alterations Are Recapitulated in iPSC-Derived Astrocytes. Annals Of Neurology. 2022;91(5):652-669. PubMed |
Littau, Jessica Lisa; Velilla, Lina; Hase, Yoshiki; Villalba-Moreno, Nelson David; Hagel, Christian; Drexler, Dagmar; Osorio Restrepo, Santiago; Villegas, Andres; Lopera, Francisco; Vargas, Sergio; Glatzel, Markus; Krasemann, Susanne; Quiroz, Yakeel T; Arboleda-Velasquez, Joseph F; Kalaria, Rajesh; Sepulveda-Falla, Diego. Evidence of beta amyloid independent small vessel disease in familial Alzheimer's disease. Brain Pathology (Zurich, Switzerland). 2022;32(6):e13097. PubMed |
Wood, John P M; Chidlow, Glyn; Halliday, Luke A; Casson, Robert J; Selva, Dinesh; Sun, Michelle. Histochemical Comparison of Human and Rat Lacrimal Glands: Implications for Bio-Engineering Studies. Translational Vision Science & Technology. 2022;11(11):10. PubMed |
Domingo-Muelas, Ana; Duart-Abadia, Pere; Morante-Redolat, Jose Manuel; Jordán-Pla, Antonio; Belenguer, Germán; Fabra-Beser, Jaime; Paniagua-Herranz, Lucía; Pérez-Villalba, Ana; Álvarez-Varela, Adrián; Barriga, Francisco M; Gil-Sanz, Cristina; Ortega, Felipe; Batlle, Eduard; Fariñas, Isabel. Post-transcriptional control of a stemness signature by RNA-binding protein MEX3A regulates murine adult neurogenesis. Nature Communications. 2023;14(1):373. PubMed |
Ben-Nejma, Inès R H; Keliris, Aneta J; Vanreusel, Verdi; Ponsaerts, Peter; Van der Linden, Annemie; Keliris, Georgios A. Altered dynamics of glymphatic flow in a mature-onset Tet-off APP mouse model of amyloidosis. Alzheimer's Research & Therapy. 2023;15(1):23. PubMed |
Rao, Wei; Wang, Shan; Duleba, Marcin; Niroula, Suchan; Goller, Kristina; Xie, Jingzhong; Mahalingam, Rajasekaran; Neupane, Rahul; Liew, Audrey-Ann; Vincent, Matthew; Okuda, Kenichi; O'Neal, Wanda K; Boucher, Richard C; Dickey, Burton F; Wechsler, Michael E; Ibrahim, Omar; Engelhardt, John F; Mertens, Tinne C J; Wang, Wei; Jyothula, Soma S K; Crum, Christopher P; Karmouty-Quintana, Harry; Parekh, Kalpaj R; Metersky, Mark L; McKeon, Frank D; Xian, Wa. Regenerative Metaplastic Clones in COPD Lung Drive Inflammation and Fibrosis. Cell. 2020;181(4):848-864.e18. PubMed |
Vasciaveo, Valeria; Iadarola, Antonella; Casile, Antonino; Dante, Davide; Morello, Giulia; Minotta, Lorenzo; Tamagno, Elena; Cicolin, Alessandro; Guglielmotto, Michela. Sleep fragmentation affects glymphatic system through the different expression of AQP4 in wild type and 5xFAD mouse models. Acta Neuropathologica Communications. 2023;11(1):16. PubMed |