Anti AQP3 pAb (ATL-HPA014924 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA014924-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: aquaporin 3 (Gill blood group)
Gene Name: AQP3
Alternative Gene Name: GIL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028435: 94%, ENSRNOG00000009797: 87%
Entrez Gene ID: 360
Uniprot ID: Q92482
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QLMIGCHLEQPPPSNEEENVKLAHVKHKEQI
Gene Sequence QLMIGCHLEQPPPSNEEENVKLAHVKHKEQI
Gene ID - Mouse ENSMUSG00000028435
Gene ID - Rat ENSRNOG00000009797
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti AQP3 pAb (ATL-HPA014924 w/enhanced validation)
Datasheet Anti AQP3 pAb (ATL-HPA014924 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AQP3 pAb (ATL-HPA014924 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti AQP3 pAb (ATL-HPA014924 w/enhanced validation)
Datasheet Anti AQP3 pAb (ATL-HPA014924 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti AQP3 pAb (ATL-HPA014924 w/enhanced validation)
Citations for Anti AQP3 pAb (ATL-HPA014924 w/enhanced validation) – 3 Found
Niu, Dongfeng; Bai, Yanhua; Yao, Qian; Hou, Wei; Zhou, Lixin; Huang, Xiaozheng; Zhao, Chen. Expression and Significance of AQP3 in Cutaneous Lesions. Analytical Cellular Pathology (Amsterdam). 2021( 34745849):7866471.  PubMed
Dupuis, Camie; Robert, Arnaud; Gerard, Ludovic; Morelle, Johann; Laterre, Pierre-François; Hantson, Philippe. Nephrogenic Diabetes Insipidus following an Off-Label Administration of Sevoflurane for Prolonged Sedation in a COVID-19 Patient and Possible Influence on Aquaporin-2 Renal Expression. Case Reports In Anesthesiology. 2022( 35310519):3312306.  PubMed
Nery, Flávia C; Siranosian, Jennifer J; Rosales, Ivy; Deguise, Marc-Olivier; Sharma, Amita; Muhtaseb, Abdurrahman W; Nwe, Pann; Johnstone, Alec J; Zhang, Ren; Fatouraei, Maryam; Huemer, Natassja; Alves, Christiano R R; Kothary, Rashmi; Swoboda, Kathryn J. Impaired kidney structure and function in spinal muscular atrophy. Neurology. Genetics. 2019;5(5):e353.  PubMed