Anti AQP3 pAb (ATL-HPA014924 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA014924-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: AQP3
Alternative Gene Name: GIL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028435: 94%, ENSRNOG00000009797: 87%
Entrez Gene ID: 360
Uniprot ID: Q92482
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QLMIGCHLEQPPPSNEEENVKLAHVKHKEQI |
| Gene Sequence | QLMIGCHLEQPPPSNEEENVKLAHVKHKEQI |
| Gene ID - Mouse | ENSMUSG00000028435 |
| Gene ID - Rat | ENSRNOG00000009797 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AQP3 pAb (ATL-HPA014924 w/enhanced validation) | |
| Datasheet | Anti AQP3 pAb (ATL-HPA014924 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti AQP3 pAb (ATL-HPA014924 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti AQP3 pAb (ATL-HPA014924 w/enhanced validation) | |
| Datasheet | Anti AQP3 pAb (ATL-HPA014924 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti AQP3 pAb (ATL-HPA014924 w/enhanced validation) |
| Citations for Anti AQP3 pAb (ATL-HPA014924 w/enhanced validation) – 3 Found |
| Niu, Dongfeng; Bai, Yanhua; Yao, Qian; Hou, Wei; Zhou, Lixin; Huang, Xiaozheng; Zhao, Chen. Expression and Significance of AQP3 in Cutaneous Lesions. Analytical Cellular Pathology (Amsterdam). 2021( 34745849):7866471. PubMed |
| Dupuis, Camie; Robert, Arnaud; Gerard, Ludovic; Morelle, Johann; Laterre, Pierre-François; Hantson, Philippe. Nephrogenic Diabetes Insipidus following an Off-Label Administration of Sevoflurane for Prolonged Sedation in a COVID-19 Patient and Possible Influence on Aquaporin-2 Renal Expression. Case Reports In Anesthesiology. 2022( 35310519):3312306. PubMed |
| Nery, Flávia C; Siranosian, Jennifer J; Rosales, Ivy; Deguise, Marc-Olivier; Sharma, Amita; Muhtaseb, Abdurrahman W; Nwe, Pann; Johnstone, Alec J; Zhang, Ren; Fatouraei, Maryam; Huemer, Natassja; Alves, Christiano R R; Kothary, Rashmi; Swoboda, Kathryn J. Impaired kidney structure and function in spinal muscular atrophy. Neurology. Genetics. 2019;5(5):e353. PubMed |