Anti AQP2 pAb (ATL-HPA046834 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046834-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: AQP2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023013: 91%, ENSRNOG00000054378: 93%
Entrez Gene ID: 359
Uniprot ID: P41181
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VLFPPAKSLSERLAVLKGLEPDTDWEEREVRRRQSVELHSPQSL |
| Gene Sequence | VLFPPAKSLSERLAVLKGLEPDTDWEEREVRRRQSVELHSPQSL |
| Gene ID - Mouse | ENSMUSG00000023013 |
| Gene ID - Rat | ENSRNOG00000054378 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AQP2 pAb (ATL-HPA046834 w/enhanced validation) | |
| Datasheet | Anti AQP2 pAb (ATL-HPA046834 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti AQP2 pAb (ATL-HPA046834 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti AQP2 pAb (ATL-HPA046834 w/enhanced validation) | |
| Datasheet | Anti AQP2 pAb (ATL-HPA046834 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti AQP2 pAb (ATL-HPA046834 w/enhanced validation) |
| Citations for Anti AQP2 pAb (ATL-HPA046834 w/enhanced validation) – 2 Found |
| Landegren, Nils; Pourmousa Lindberg, Mina; Skov, Jakob; Hallgren, Åsa; Eriksson, Daniel; Lisberg Toft-Bertelsen, Trine; MacAulay, Nanna; Hagforsen, Eva; Räisänen-Sokolowski, Anne; Saha, Heikki; Nilsson, Thomas; Nordmark, Gunnel; Ohlsson, Sophie; Gustafsson, Jan; Husebye, Eystein S; Larsson, Erik; Anderson, Mark S; Perheentupa, Jaakko; Rorsman, Fredrik; Fenton, Robert A; Kämpe, Olle. Autoantibodies Targeting a Collecting Duct-Specific Water Channel in Tubulointerstitial Nephritis. Journal Of The American Society Of Nephrology : Jasn. 2016;27(10):3220-3228. PubMed |
| Czerniecki, Stefan M; Cruz, Nelly M; Harder, Jennifer L; Menon, Rajasree; Annis, James; Otto, Edgar A; Gulieva, Ramila E; Islas, Laura V; Kim, Yong Kyun; Tran, Linh M; Martins, Timothy J; Pippin, Jeffrey W; Fu, Hongxia; Kretzler, Matthias; Shankland, Stuart J; Himmelfarb, Jonathan; Moon, Randall T; Paragas, Neal; Freedman, Benjamin S. High-Throughput Screening Enhances Kidney Organoid Differentiation from Human Pluripotent Stem Cells and Enables Automated Multidimensional Phenotyping. Cell Stem Cell. 2018;22(6):929-940.e4. PubMed |