Anti AQP2 pAb (ATL-HPA046834 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA046834-25

• 

Protein Description: aquaporin 2 (collecting duct)
Gene Name: AQP2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023013: 91%, ENSRNOG00000054378: 93%
Entrez Gene ID: 359
Uniprot ID: P41181
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VLFPPAKSLSERLAVLKGLEPDTDWEEREVRRRQSVELHSPQSL
• Gene Sequence: VLFPPAKSLSERLAVLKGLEPDTDWEEREVRRRQSVELHSPQSL
• Gene ID - Mouse: ENSMUSG00000023013
• Gene ID - Rat: ENSRNOG00000054378
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti AQP2 pAb (ATL-HPA046834 w/enhanced validation) – 2 Found

Landegren, Nils; Pourmousa Lindberg, Mina; Skov, Jakob; Hallgren, Åsa; Eriksson, Daniel; Lisberg Toft-Bertelsen, Trine; MacAulay, Nanna; Hagforsen, Eva; Räisänen-Sokolowski, Anne; Saha, Heikki; Nilsson, Thomas; Nordmark, Gunnel; Ohlsson, Sophie; Gustafsson, Jan; Husebye, Eystein S; Larsson, Erik; Anderson, Mark S; Perheentupa, Jaakko; Rorsman, Fredrik; Fenton, Robert A; Kämpe, Olle. Autoantibodies Targeting a Collecting Duct-Specific Water Channel in Tubulointerstitial Nephritis. Journal Of The American Society Of Nephrology : Jasn. 2016;27(10):3220-3228. 

Czerniecki, Stefan M; Cruz, Nelly M; Harder, Jennifer L; Menon, Rajasree; Annis, James; Otto, Edgar A; Gulieva, Ramila E; Islas, Laura V; Kim, Yong Kyun; Tran, Linh M; Martins, Timothy J; Pippin, Jeffrey W; Fu, Hongxia; Kretzler, Matthias; Shankland, Stuart J; Himmelfarb, Jonathan; Moon, Randall T; Paragas, Neal; Freedman, Benjamin S. High-Throughput Screening Enhances Kidney Organoid Differentiation from Human Pluripotent Stem Cells and Enables Automated Multidimensional Phenotyping. Cell Stem Cell. 2018;22(6):929-940.e4.