Anti AQP1 pAb (ATL-HPA019206 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA019206-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: AQP1
Alternative Gene Name: CHIP28, CO
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004655: 95%, ENSRNOG00000011648: 95%
Entrez Gene ID: 358
Uniprot ID: P29972
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK |
| Gene Sequence | PRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK |
| Gene ID - Mouse | ENSMUSG00000004655 |
| Gene ID - Rat | ENSRNOG00000011648 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti AQP1 pAb (ATL-HPA019206 w/enhanced validation) | |
| Datasheet | Anti AQP1 pAb (ATL-HPA019206 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti AQP1 pAb (ATL-HPA019206 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti AQP1 pAb (ATL-HPA019206 w/enhanced validation) | |
| Datasheet | Anti AQP1 pAb (ATL-HPA019206 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti AQP1 pAb (ATL-HPA019206 w/enhanced validation) |
| Citations for Anti AQP1 pAb (ATL-HPA019206 w/enhanced validation) – 3 Found |
| Landegren, Nils; Pourmousa Lindberg, Mina; Skov, Jakob; Hallgren, Åsa; Eriksson, Daniel; Lisberg Toft-Bertelsen, Trine; MacAulay, Nanna; Hagforsen, Eva; Räisänen-Sokolowski, Anne; Saha, Heikki; Nilsson, Thomas; Nordmark, Gunnel; Ohlsson, Sophie; Gustafsson, Jan; Husebye, Eystein S; Larsson, Erik; Anderson, Mark S; Perheentupa, Jaakko; Rorsman, Fredrik; Fenton, Robert A; Kämpe, Olle. Autoantibodies Targeting a Collecting Duct-Specific Water Channel in Tubulointerstitial Nephritis. Journal Of The American Society Of Nephrology : Jasn. 2016;27(10):3220-3228. PubMed |
| Imaizumi, Hideko; Ishibashi, Keiichiro; Takenoshita, Seiichi; Ishida, Hideyuki. Aquaporin 1 expression is associated with response to adjuvant chemotherapy in stage II and III colorectal cancer. Oncology Letters. 2018;15(5):6450-6456. PubMed |
| Tsukiyama, Tomoyuki; Kobayashi, Kenichi; Nakaya, Masataka; Iwatani, Chizuru; Seita, Yasunari; Tsuchiya, Hideaki; Matsushita, Jun; Kitajima, Kahoru; Kawamoto, Ikuo; Nakagawa, Takahiro; Fukuda, Koji; Iwakiri, Teppei; Izumi, Hiroyuki; Itagaki, Iori; Kume, Shinji; Maegawa, Hiroshi; Nishinakamura, Ryuichi; Nishio, Saori; Nakamura, Shinichiro; Kawauchi, Akihiro; Ema, Masatsugu. Monkeys mutant for PKD1 recapitulate human autosomal dominant polycystic kidney disease. Nature Communications. 2019;10(1):5517. PubMed |