Anti APRT pAb (ATL-HPA026681)

Atlas Antibodies

Catalog No.:
ATL-HPA026681-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: adenine phosphoribosyltransferase
Gene Name: APRT
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006589: 73%, ENSRNOG00000014405: 78%
Entrez Gene ID: 353
Uniprot ID: P07741
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDYIAGD
Gene Sequence MADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDYIAGD
Gene ID - Mouse ENSMUSG00000006589
Gene ID - Rat ENSRNOG00000014405
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti APRT pAb (ATL-HPA026681)
Datasheet Anti APRT pAb (ATL-HPA026681) Datasheet (External Link)
Vendor Page Anti APRT pAb (ATL-HPA026681) at Atlas Antibodies

Documents & Links for Anti APRT pAb (ATL-HPA026681)
Datasheet Anti APRT pAb (ATL-HPA026681) Datasheet (External Link)
Vendor Page Anti APRT pAb (ATL-HPA026681)