Anti APPL2 pAb (ATL-HPA043925)
Atlas Antibodies
- Catalog No.:
- ATL-HPA043925-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: APPL2
Alternative Gene Name: DIP13B, FLJ10659
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020263: 87%, ENSRNOG00000008174: 87%
Entrez Gene ID: 55198
Uniprot ID: Q8NEU8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KICYAINLGKEIIEVQKDPEALAQLMLSIPLTNDGKYVLLNDQPDDDDGNPNEHRGAESEA |
Gene Sequence | KICYAINLGKEIIEVQKDPEALAQLMLSIPLTNDGKYVLLNDQPDDDDGNPNEHRGAESEA |
Gene ID - Mouse | ENSMUSG00000020263 |
Gene ID - Rat | ENSRNOG00000008174 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti APPL2 pAb (ATL-HPA043925) | |
Datasheet | Anti APPL2 pAb (ATL-HPA043925) Datasheet (External Link) |
Vendor Page | Anti APPL2 pAb (ATL-HPA043925) at Atlas Antibodies |
Documents & Links for Anti APPL2 pAb (ATL-HPA043925) | |
Datasheet | Anti APPL2 pAb (ATL-HPA043925) Datasheet (External Link) |
Vendor Page | Anti APPL2 pAb (ATL-HPA043925) |