Anti APPL2 pAb (ATL-HPA043925)

Atlas Antibodies

Catalog No.:
ATL-HPA043925-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: adaptor protein, phosphotyrosine interaction, PH domain and leucine zipper containing 2
Gene Name: APPL2
Alternative Gene Name: DIP13B, FLJ10659
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020263: 87%, ENSRNOG00000008174: 87%
Entrez Gene ID: 55198
Uniprot ID: Q8NEU8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KICYAINLGKEIIEVQKDPEALAQLMLSIPLTNDGKYVLLNDQPDDDDGNPNEHRGAESEA
Gene Sequence KICYAINLGKEIIEVQKDPEALAQLMLSIPLTNDGKYVLLNDQPDDDDGNPNEHRGAESEA
Gene ID - Mouse ENSMUSG00000020263
Gene ID - Rat ENSRNOG00000008174
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti APPL2 pAb (ATL-HPA043925)
Datasheet Anti APPL2 pAb (ATL-HPA043925) Datasheet (External Link)
Vendor Page Anti APPL2 pAb (ATL-HPA043925) at Atlas Antibodies

Documents & Links for Anti APPL2 pAb (ATL-HPA043925)
Datasheet Anti APPL2 pAb (ATL-HPA043925) Datasheet (External Link)
Vendor Page Anti APPL2 pAb (ATL-HPA043925)