Anti APPL2 pAb (ATL-HPA039688 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA039688-25

• 
• 

Protein Description: adaptor protein, phosphotyrosine interaction, PH domain and leucine zipper containing 2
Gene Name: APPL2
Alternative Gene Name: DIP13B, FLJ10659
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020263: 88%, ENSRNOG00000008174: 90%
Entrez Gene ID: 55198
Uniprot ID: Q8NEU8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PMIGFAHGQINFFKKGAEMFSKRMDSFLSSVADMVQSIQVELEAEAEKMRVSQQELLSVDESVYTPDSDVAAPQINRNLIQK
• Gene Sequence: PMIGFAHGQINFFKKGAEMFSKRMDSFLSSVADMVQSIQVELEAEAEKMRVSQQELLSVDESVYTPDSDVAAPQINRNLIQK
• Gene ID - Mouse: ENSMUSG00000020263
• Gene ID - Rat: ENSRNOG00000008174
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.