Anti APPL1 pAb (ATL-HPA011138)

Atlas Antibodies

SKU: ATL-HPA011138-25

• 

Protein Description: adaptor protein, phosphotyrosine interaction, PH domain and leucine zipper containing 1
Gene Name: APPL1
Alternative Gene Name: APPL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040760: 98%, ENSRNOG00000013574: 96%
Entrez Gene ID: 26060
Uniprot ID: Q9UKG1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VTRLTFPLPCVVLYATHQENKRLFGFVLRTSSGRSESNLSSVCYIFESNNEGEKICDSVGLAKQIALHAELDRRASEKQKEIERVKEKQQKELNKQKQIEKDLEEQ
• Gene Sequence: VTRLTFPLPCVVLYATHQENKRLFGFVLRTSSGRSESNLSSVCYIFESNNEGEKICDSVGLAKQIALHAELDRRASEKQKEIERVKEKQQKELNKQKQIEKDLEEQ
• Gene ID - Mouse: ENSMUSG00000040760
• Gene ID - Rat: ENSRNOG00000013574
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.