Anti APPL1 pAb (ATL-HPA011138)

Atlas Antibodies

Catalog No.:
ATL-HPA011138-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: adaptor protein, phosphotyrosine interaction, PH domain and leucine zipper containing 1
Gene Name: APPL1
Alternative Gene Name: APPL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040760: 98%, ENSRNOG00000013574: 96%
Entrez Gene ID: 26060
Uniprot ID: Q9UKG1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VTRLTFPLPCVVLYATHQENKRLFGFVLRTSSGRSESNLSSVCYIFESNNEGEKICDSVGLAKQIALHAELDRRASEKQKEIERVKEKQQKELNKQKQIEKDLEEQ
Gene Sequence VTRLTFPLPCVVLYATHQENKRLFGFVLRTSSGRSESNLSSVCYIFESNNEGEKICDSVGLAKQIALHAELDRRASEKQKEIERVKEKQQKELNKQKQIEKDLEEQ
Gene ID - Mouse ENSMUSG00000040760
Gene ID - Rat ENSRNOG00000013574
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti APPL1 pAb (ATL-HPA011138)
Datasheet Anti APPL1 pAb (ATL-HPA011138) Datasheet (External Link)
Vendor Page Anti APPL1 pAb (ATL-HPA011138) at Atlas Antibodies

Documents & Links for Anti APPL1 pAb (ATL-HPA011138)
Datasheet Anti APPL1 pAb (ATL-HPA011138) Datasheet (External Link)
Vendor Page Anti APPL1 pAb (ATL-HPA011138)