Anti APPBP2 pAb (ATL-HPA078370)

Atlas Antibodies

Catalog No.: ATL-HPA078370-25

Protein Description: amyloid beta precursor protein binding protein 2
Gene Name: APPBP2
Alternative Gene Name: Hs.84084, KIAA0228, PAT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018481: 100%, ENSRNOG00000027654: 99%
Entrez Gene ID: 10513
Uniprot ID: Q92624
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ALSVGHLASLYNYDMNQYENAEKLYLRSIAIGKKLFGEGYSGLEYDYRGLIKLYNSIGNYEKVFEYHNVLSNW
• Gene Sequence: ALSVGHLASLYNYDMNQYENAEKLYLRSIAIGKKLFGEGYSGLEYDYRGLIKLYNSIGNYEKVFEYHNVLSNW
• Gene ID - Mouse: ENSMUSG00000018481
• Gene ID - Rat: ENSRNOG00000027654
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.