Anti APPBP2 pAb (ATL-HPA078370)
Atlas Antibodies
- Catalog No.:
- ATL-HPA078370-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: APPBP2
Alternative Gene Name: Hs.84084, KIAA0228, PAT1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018481: 100%, ENSRNOG00000027654: 99%
Entrez Gene ID: 10513
Uniprot ID: Q92624
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ALSVGHLASLYNYDMNQYENAEKLYLRSIAIGKKLFGEGYSGLEYDYRGLIKLYNSIGNYEKVFEYHNVLSNW |
| Gene Sequence | ALSVGHLASLYNYDMNQYENAEKLYLRSIAIGKKLFGEGYSGLEYDYRGLIKLYNSIGNYEKVFEYHNVLSNW |
| Gene ID - Mouse | ENSMUSG00000018481 |
| Gene ID - Rat | ENSRNOG00000027654 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti APPBP2 pAb (ATL-HPA078370) | |
| Datasheet | Anti APPBP2 pAb (ATL-HPA078370) Datasheet (External Link) |
| Vendor Page | Anti APPBP2 pAb (ATL-HPA078370) at Atlas Antibodies |
| Documents & Links for Anti APPBP2 pAb (ATL-HPA078370) | |
| Datasheet | Anti APPBP2 pAb (ATL-HPA078370) Datasheet (External Link) |
| Vendor Page | Anti APPBP2 pAb (ATL-HPA078370) |