Anti APP pAb (ATL-HPA001462 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA001462-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: amyloid beta (A4) precursor protein
Gene Name: APP
Alternative Gene Name: AD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022892: 95%, ENSRNOG00000006997: 95%
Entrez Gene ID: 351
Uniprot ID: P05067
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAKDVGSN
Gene Sequence ANMISEPRISYGNDALMPSLTETKTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEVEPVDARPAADRGLTTRPGSGLTNIKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAKDVGSN
Gene ID - Mouse ENSMUSG00000022892
Gene ID - Rat ENSRNOG00000006997
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti APP pAb (ATL-HPA001462 w/enhanced validation)
Datasheet Anti APP pAb (ATL-HPA001462 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti APP pAb (ATL-HPA001462 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti APP pAb (ATL-HPA001462 w/enhanced validation)
Datasheet Anti APP pAb (ATL-HPA001462 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti APP pAb (ATL-HPA001462 w/enhanced validation)
Citations for Anti APP pAb (ATL-HPA001462 w/enhanced validation) – 2 Found
Wu, Chih-Ching; Hsu, Chia-Wei; Chen, Chi-De; Yu, Chia-Jung; Chang, Kai-Ping; Tai, Dar-In; Liu, Hao-Ping; Su, Wen-Hui; Chang, Yu-Sun; Yu, Jau-Song. Candidate serological biomarkers for cancer identified from the secretomes of 23 cancer cell lines and the human protein atlas. Molecular & Cellular Proteomics : Mcp. 2010;9(6):1100-17.  PubMed
Oi, Ryoko; Koizumi, Hirotaka; Maeda, Ichiro; Noguchi, Akira; Tatsunami, Shinobu; Iwatani, Tsuguo; Kawamoto, Hisanori; Tsugawa, Koichiro; Takagi, Masayuki. Clinicopathological Significance of TARBP2, APP, and ZNF395 in Breast Cancer. Breast Cancer : Basic And Clinical Research. 10( 27980417):211-221.  PubMed