Anti APOOL pAb (ATL-HPA000612 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA000612-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: apolipoprotein O-like
Gene Name: APOOL
Alternative Gene Name: AAIR8193, CXorf33, FAM121A, UNQ8193
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025525: 70%, ENSRNOG00000004512: 70%
Entrez Gene ID: 139322
Uniprot ID: Q6UXV4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen ATLGATVCYPVQSVIIAKVTAKKVYATSQQIFGAVKSLWTKSSKEESLPKPKEKTKLGSSSEIEVPAKTTHVLKHSVPLPTELSSEAKTKSESTSGATQFMPDPKLMDHGQSHPED
Gene Sequence ATLGATVCYPVQSVIIAKVTAKKVYATSQQIFGAVKSLWTKSSKEESLPKPKEKTKLGSSSEIEVPAKTTHVLKHSVPLPTELSSEAKTKSESTSGATQFMPDPKLMDHGQSHPED
Gene ID - Mouse ENSMUSG00000025525
Gene ID - Rat ENSRNOG00000004512
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti APOOL pAb (ATL-HPA000612 w/enhanced validation)
Datasheet Anti APOOL pAb (ATL-HPA000612 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti APOOL pAb (ATL-HPA000612 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti APOOL pAb (ATL-HPA000612 w/enhanced validation)
Datasheet Anti APOOL pAb (ATL-HPA000612 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti APOOL pAb (ATL-HPA000612 w/enhanced validation)
Citations for Anti APOOL pAb (ATL-HPA000612 w/enhanced validation) – 9 Found
Anand, Ruchika; Strecker, Valentina; Urbach, Jennifer; Wittig, Ilka; Reichert, Andreas S. Mic13 Is Essential for Formation of Crista Junctions in Mammalian Cells. Plos One. 11(8):e0160258.  PubMed
Tameling, Carla; Stoldt, Stefan; Stephan, Till; Naas, Julia; Jakobs, Stefan; Munk, Axel. Colocalization for super-resolution microscopy via optimal transport. Nature Computational Science. 2021;1( 35874932):199-211.  PubMed
Mulder, J; Wernérus, H; Shi, T-J; Pontén, F; Hober, S; Uhlén, M; Hökfelt, T. Systematically generated antibodies against human gene products: high throughput screening on sections from the rat nervous system. Neuroscience. 2007;146(4):1689-703.  PubMed
Mulder, Jan; Björling, Erik; Jonasson, Kalle; Wernérus, Henrik; Hober, Sophia; Hökfelt, Tomas; Uhlén, Mathias. Tissue profiling of the mammalian central nervous system using human antibody-based proteomics. Molecular & Cellular Proteomics : Mcp. 2009;8(7):1612-22.  PubMed
Weber, Tobias A; Koob, Sebastian; Heide, Heinrich; Wittig, Ilka; Head, Brian; van der Bliek, Alexander; Brandt, Ulrich; Mittelbronn, Michel; Reichert, Andreas S. APOOL is a cardiolipin-binding constituent of the Mitofilin/MINOS protein complex determining cristae morphology in mammalian mitochondria. Plos One. 8(5):e63683.  PubMed
Huang, Xiaoping; Wu, Beverly P; Nguyen, Diana; Liu, Yi-Ting; Marani, Melika; Hench, Jürgen; Bénit, Paule; Kozjak-Pavlovic, Vera; Rustin, Pierre; Frank, Stephan; Narendra, Derek P. CHCHD2 accumulates in distressed mitochondria and facilitates oligomerization of CHCHD10. Human Molecular Genetics. 2018;27(22):3881-3900.  PubMed
Kondadi, Arun Kumar; Anand, Ruchika; Hänsch, Sebastian; Urbach, Jennifer; Zobel, Thomas; Wolf, Dane M; Segawa, Mayuko; Liesa, Marc; Shirihai, Orian S; Weidtkamp-Peters, Stefanie; Reichert, Andreas S. Cristae undergo continuous cycles of membrane remodelling in a MICOS-dependent manner. Embo Reports. 2020;21(3):e49776.  PubMed
Liu, Yi-Ting; Huang, Xiaoping; Nguyen, Diana; Shammas, Mario K; Wu, Beverly P; Dombi, Eszter; Springer, Danielle A; Poulton, Joanna; Sekine, Shiori; Narendra, Derek P. Loss of CHCHD2 and CHCHD10 activates OMA1 peptidase to disrupt mitochondrial cristae phenocopying patient mutations. Human Molecular Genetics. 2020;29(9):1547-1567.  PubMed
Anand, Ruchika; Kondadi, Arun Kumar; Meisterknecht, Jana; Golombek, Mathias; Nortmann, Oliver; Riedel, Julia; Peifer-Weiß, Leon; Brocke-Ahmadinejad, Nahal; Schlütermann, David; Stork, Björn; Eichmann, Thomas O; Wittig, Ilka; Reichert, Andreas S. MIC26 and MIC27 cooperate to regulate cardiolipin levels and the landscape of OXPHOS complexes. Life Science Alliance. 2020;3(10)  PubMed