Anti APOOL pAb (ATL-HPA000612 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA000612-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: APOOL
Alternative Gene Name: AAIR8193, CXorf33, FAM121A, UNQ8193
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025525: 70%, ENSRNOG00000004512: 70%
Entrez Gene ID: 139322
Uniprot ID: Q6UXV4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human, Mouse, Rat |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ATLGATVCYPVQSVIIAKVTAKKVYATSQQIFGAVKSLWTKSSKEESLPKPKEKTKLGSSSEIEVPAKTTHVLKHSVPLPTELSSEAKTKSESTSGATQFMPDPKLMDHGQSHPED |
Gene Sequence | ATLGATVCYPVQSVIIAKVTAKKVYATSQQIFGAVKSLWTKSSKEESLPKPKEKTKLGSSSEIEVPAKTTHVLKHSVPLPTELSSEAKTKSESTSGATQFMPDPKLMDHGQSHPED |
Gene ID - Mouse | ENSMUSG00000025525 |
Gene ID - Rat | ENSRNOG00000004512 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti APOOL pAb (ATL-HPA000612 w/enhanced validation) | |
Datasheet | Anti APOOL pAb (ATL-HPA000612 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti APOOL pAb (ATL-HPA000612 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti APOOL pAb (ATL-HPA000612 w/enhanced validation) | |
Datasheet | Anti APOOL pAb (ATL-HPA000612 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti APOOL pAb (ATL-HPA000612 w/enhanced validation) |
Citations for Anti APOOL pAb (ATL-HPA000612 w/enhanced validation) – 9 Found |
Anand, Ruchika; Strecker, Valentina; Urbach, Jennifer; Wittig, Ilka; Reichert, Andreas S. Mic13 Is Essential for Formation of Crista Junctions in Mammalian Cells. Plos One. 11(8):e0160258. PubMed |
Tameling, Carla; Stoldt, Stefan; Stephan, Till; Naas, Julia; Jakobs, Stefan; Munk, Axel. Colocalization for super-resolution microscopy via optimal transport. Nature Computational Science. 2021;1( 35874932):199-211. PubMed |
Mulder, J; Wernérus, H; Shi, T-J; Pontén, F; Hober, S; Uhlén, M; Hökfelt, T. Systematically generated antibodies against human gene products: high throughput screening on sections from the rat nervous system. Neuroscience. 2007;146(4):1689-703. PubMed |
Mulder, Jan; Björling, Erik; Jonasson, Kalle; Wernérus, Henrik; Hober, Sophia; Hökfelt, Tomas; Uhlén, Mathias. Tissue profiling of the mammalian central nervous system using human antibody-based proteomics. Molecular & Cellular Proteomics : Mcp. 2009;8(7):1612-22. PubMed |
Weber, Tobias A; Koob, Sebastian; Heide, Heinrich; Wittig, Ilka; Head, Brian; van der Bliek, Alexander; Brandt, Ulrich; Mittelbronn, Michel; Reichert, Andreas S. APOOL is a cardiolipin-binding constituent of the Mitofilin/MINOS protein complex determining cristae morphology in mammalian mitochondria. Plos One. 8(5):e63683. PubMed |
Huang, Xiaoping; Wu, Beverly P; Nguyen, Diana; Liu, Yi-Ting; Marani, Melika; Hench, Jürgen; Bénit, Paule; Kozjak-Pavlovic, Vera; Rustin, Pierre; Frank, Stephan; Narendra, Derek P. CHCHD2 accumulates in distressed mitochondria and facilitates oligomerization of CHCHD10. Human Molecular Genetics. 2018;27(22):3881-3900. PubMed |
Kondadi, Arun Kumar; Anand, Ruchika; Hänsch, Sebastian; Urbach, Jennifer; Zobel, Thomas; Wolf, Dane M; Segawa, Mayuko; Liesa, Marc; Shirihai, Orian S; Weidtkamp-Peters, Stefanie; Reichert, Andreas S. Cristae undergo continuous cycles of membrane remodelling in a MICOS-dependent manner. Embo Reports. 2020;21(3):e49776. PubMed |
Liu, Yi-Ting; Huang, Xiaoping; Nguyen, Diana; Shammas, Mario K; Wu, Beverly P; Dombi, Eszter; Springer, Danielle A; Poulton, Joanna; Sekine, Shiori; Narendra, Derek P. Loss of CHCHD2 and CHCHD10 activates OMA1 peptidase to disrupt mitochondrial cristae phenocopying patient mutations. Human Molecular Genetics. 2020;29(9):1547-1567. PubMed |
Anand, Ruchika; Kondadi, Arun Kumar; Meisterknecht, Jana; Golombek, Mathias; Nortmann, Oliver; Riedel, Julia; Peifer-Weiß, Leon; Brocke-Ahmadinejad, Nahal; Schlütermann, David; Stork, Björn; Eichmann, Thomas O; Wittig, Ilka; Reichert, Andreas S. MIC26 and MIC27 cooperate to regulate cardiolipin levels and the landscape of OXPHOS complexes. Life Science Alliance. 2020;3(10) PubMed |