Anti APOO pAb (ATL-HPA003187)

Atlas Antibodies

SKU: ATL-HPA003187-25

• 
• 
• 

Protein Description: apolipoprotein O
Gene Name: APOO
Alternative Gene Name: FAM121B, MGC4825, My025
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049233: 85%, ENSRNOG00000046918: 80%
Entrez Gene ID: 79135
Uniprot ID: Q9BUR5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IKKLVYPPGFMGLAASLYYPQQAIVFAQVSGERLYDWGLRGYIVIEDLWKENFQKPGNVKNSPGTK
• Gene Sequence: IKKLVYPPGFMGLAASLYYPQQAIVFAQVSGERLYDWGLRGYIVIEDLWKENFQKPGNVKNSPGTK
• Gene ID - Mouse: ENSMUSG00000049233
• Gene ID - Rat: ENSRNOG00000046918
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.