Anti APOL6 pAb (ATL-HPA029167 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA029167-25
  • Immunohistochemical staining of human cerebral cortex shows strong nucleolar and cytoplasmic positivity in neuronal cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & nuclear bodies.
  • Western blot analysis in human cell line A-431 and human cell line HEK 293.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: apolipoprotein L, 6
Gene Name: APOL6
Alternative Gene Name: APOL-VI, APOLVI
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033576: 38%, ENSRNOG00000042771: 32%
Entrez Gene ID: 80830
Uniprot ID: Q9BWW8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MDNQAERESEAGVGLQRDEDDAPLCEDVELQDGDLSPEEKIFLREFPRLKEDLKGNIDKLRALADDIDKTHKKFTKAN
Gene Sequence MDNQAERESEAGVGLQRDEDDAPLCEDVELQDGDLSPEEKIFLREFPRLKEDLKGNIDKLRALADDIDKTHKKFTKAN
Gene ID - Mouse ENSMUSG00000033576
Gene ID - Rat ENSRNOG00000042771
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti APOL6 pAb (ATL-HPA029167 w/enhanced validation)
Datasheet Anti APOL6 pAb (ATL-HPA029167 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti APOL6 pAb (ATL-HPA029167 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti APOL6 pAb (ATL-HPA029167 w/enhanced validation)
Datasheet Anti APOL6 pAb (ATL-HPA029167 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti APOL6 pAb (ATL-HPA029167 w/enhanced validation)