Anti APOL5 pAb (ATL-HPA040968)
Atlas Antibodies
- Catalog No.:
- ATL-HPA040968-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: APOL5
Alternative Gene Name: APOLV
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071716: 26%, ENSRNOG00000016306: 22%
Entrez Gene ID: 80831
Uniprot ID: Q9BWW9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | AITNIVTNVLENRSNSAARDKASRLGPLTTSHEAFGGINWSEIEAAGFCVNKCVKAIQGIKDLHAYQMAKSNSGFMAMVKNFV |
Gene Sequence | AITNIVTNVLENRSNSAARDKASRLGPLTTSHEAFGGINWSEIEAAGFCVNKCVKAIQGIKDLHAYQMAKSNSGFMAMVKNFV |
Gene ID - Mouse | ENSMUSG00000071716 |
Gene ID - Rat | ENSRNOG00000016306 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti APOL5 pAb (ATL-HPA040968) | |
Datasheet | Anti APOL5 pAb (ATL-HPA040968) Datasheet (External Link) |
Vendor Page | Anti APOL5 pAb (ATL-HPA040968) at Atlas Antibodies |
Documents & Links for Anti APOL5 pAb (ATL-HPA040968) | |
Datasheet | Anti APOL5 pAb (ATL-HPA040968) Datasheet (External Link) |
Vendor Page | Anti APOL5 pAb (ATL-HPA040968) |