Anti APOL5 pAb (ATL-HPA040968)

Atlas Antibodies

Catalog No.:
ATL-HPA040968-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: apolipoprotein L, 5
Gene Name: APOL5
Alternative Gene Name: APOLV
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071716: 26%, ENSRNOG00000016306: 22%
Entrez Gene ID: 80831
Uniprot ID: Q9BWW9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AITNIVTNVLENRSNSAARDKASRLGPLTTSHEAFGGINWSEIEAAGFCVNKCVKAIQGIKDLHAYQMAKSNSGFMAMVKNFV
Gene Sequence AITNIVTNVLENRSNSAARDKASRLGPLTTSHEAFGGINWSEIEAAGFCVNKCVKAIQGIKDLHAYQMAKSNSGFMAMVKNFV
Gene ID - Mouse ENSMUSG00000071716
Gene ID - Rat ENSRNOG00000016306
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti APOL5 pAb (ATL-HPA040968)
Datasheet Anti APOL5 pAb (ATL-HPA040968) Datasheet (External Link)
Vendor Page Anti APOL5 pAb (ATL-HPA040968) at Atlas Antibodies

Documents & Links for Anti APOL5 pAb (ATL-HPA040968)
Datasheet Anti APOL5 pAb (ATL-HPA040968) Datasheet (External Link)
Vendor Page Anti APOL5 pAb (ATL-HPA040968)