Anti APOL4 pAb (ATL-HPA049797)

Atlas Antibodies

Catalog No.:
ATL-HPA049797-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: apolipoprotein L, 4
Gene Name: APOL4
Alternative Gene Name: APOLIV
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031543: 28%, ENSRNOG00000018241: 28%
Entrez Gene ID: 80832
Uniprot ID: Q9BPW4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TSTDQLEALRDILRDITPNVLSFALDFDEATKMIANDVHTLRRSKATVGRPLIAWRYVPINVVETLRTRGAPTRIVRKVARNL
Gene Sequence TSTDQLEALRDILRDITPNVLSFALDFDEATKMIANDVHTLRRSKATVGRPLIAWRYVPINVVETLRTRGAPTRIVRKVARNL
Gene ID - Mouse ENSMUSG00000031543
Gene ID - Rat ENSRNOG00000018241
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti APOL4 pAb (ATL-HPA049797)
Datasheet Anti APOL4 pAb (ATL-HPA049797) Datasheet (External Link)
Vendor Page Anti APOL4 pAb (ATL-HPA049797) at Atlas Antibodies

Documents & Links for Anti APOL4 pAb (ATL-HPA049797)
Datasheet Anti APOL4 pAb (ATL-HPA049797) Datasheet (External Link)
Vendor Page Anti APOL4 pAb (ATL-HPA049797)