Anti APOL3 pAb (ATL-HPA036228)

Atlas Antibodies

Catalog No.:
ATL-HPA036228-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: apolipoprotein L, 3
Gene Name: APOL3
Alternative Gene Name: APOLIII, CG12-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031552: 29%, ENSRNOG00000052814: 25%
Entrez Gene ID: 80833
Uniprot ID: O95236
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TFTFPFGFQGISQRLENVSGYYADARLEVGSTQLRTAGSCSHSFKRSFLEKKRFTEEATKYFRERVSPVHLQILL
Gene Sequence TFTFPFGFQGISQRLENVSGYYADARLEVGSTQLRTAGSCSHSFKRSFLEKKRFTEEATKYFRERVSPVHLQILL
Gene ID - Mouse ENSMUSG00000031552
Gene ID - Rat ENSRNOG00000052814
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti APOL3 pAb (ATL-HPA036228)
Datasheet Anti APOL3 pAb (ATL-HPA036228) Datasheet (External Link)
Vendor Page Anti APOL3 pAb (ATL-HPA036228) at Atlas Antibodies

Documents & Links for Anti APOL3 pAb (ATL-HPA036228)
Datasheet Anti APOL3 pAb (ATL-HPA036228) Datasheet (External Link)
Vendor Page Anti APOL3 pAb (ATL-HPA036228)