Anti APOL2 pAb (ATL-HPA001078 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA001078-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: APOL2
Alternative Gene Name: APOL-II
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056656: 34%, ENSRNOG00000048451: 37%
Entrez Gene ID: 23780
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LGVRVREEEAGTRVKENLPVWTVTGELQGKPLGNPAAGTMNPESSIFIEDYLKYFQDQVSRENLLQLLTDDEAWNGFVAAAELPRDEADELRKALNKLASHMVMKDKNRHDKDQQHRQWFLKEFPRLKRELEDHIRKLRALAEEVEQVHR |
| Gene Sequence | LGVRVREEEAGTRVKENLPVWTVTGELQGKPLGNPAAGTMNPESSIFIEDYLKYFQDQVSRENLLQLLTDDEAWNGFVAAAELPRDEADELRKALNKLASHMVMKDKNRHDKDQQHRQWFLKEFPRLKRELEDHIRKLRALAEEVEQVHR |
| Gene ID - Mouse | ENSMUSG00000056656 |
| Gene ID - Rat | ENSRNOG00000048451 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti APOL2 pAb (ATL-HPA001078 w/enhanced validation) | |
| Datasheet | Anti APOL2 pAb (ATL-HPA001078 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti APOL2 pAb (ATL-HPA001078 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti APOL2 pAb (ATL-HPA001078 w/enhanced validation) | |
| Datasheet | Anti APOL2 pAb (ATL-HPA001078 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti APOL2 pAb (ATL-HPA001078 w/enhanced validation) |
| Citations for Anti APOL2 pAb (ATL-HPA001078 w/enhanced validation) – 2 Found |
| Müller, Daria; Schmitz, Jürgen; Fischer, Katharina; Granado, Daniel; Groh, Ann-Christin; Krausel, Vanessa; Lüttgenau, Simona Mareike; Amelung, Till Maximilian; Pavenstädt, Hermann; Weide, Thomas. Evolution of Renal-Disease Factor APOL1 Results in Cis and Trans Orientations at the Endoplasmic Reticulum That Both Show Cytotoxic Effects. Molecular Biology And Evolution. 2021;38(11):4962-4976. PubMed |
| Galindo-Moreno, J; Iurlaro, R; El Mjiyad, N; Díez-Pérez, J; Gabaldón, T; Muñoz-Pinedo, C. Apolipoprotein L2 contains a BH3-like domain but it does not behave as a BH3-only protein. Cell Death & Disease. 2014;5(6):e1275. PubMed |