Anti APOL2 pAb (ATL-HPA001078 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA001078-25

• 
• 
• 

Protein Description: apolipoprotein L, 2
Gene Name: APOL2
Alternative Gene Name: APOL-II
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056656: 34%, ENSRNOG00000048451: 37%
Entrez Gene ID: 23780
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LGVRVREEEAGTRVKENLPVWTVTGELQGKPLGNPAAGTMNPESSIFIEDYLKYFQDQVSRENLLQLLTDDEAWNGFVAAAELPRDEADELRKALNKLASHMVMKDKNRHDKDQQHRQWFLKEFPRLKRELEDHIRKLRALAEEVEQVHR
• Gene Sequence: LGVRVREEEAGTRVKENLPVWTVTGELQGKPLGNPAAGTMNPESSIFIEDYLKYFQDQVSRENLLQLLTDDEAWNGFVAAAELPRDEADELRKALNKLASHMVMKDKNRHDKDQQHRQWFLKEFPRLKRELEDHIRKLRALAEEVEQVHR
• Gene ID - Mouse: ENSMUSG00000056656
• Gene ID - Rat: ENSRNOG00000048451
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti APOL2 pAb (ATL-HPA001078 w/enhanced validation) – 2 Found

Müller, Daria; Schmitz, Jürgen; Fischer, Katharina; Granado, Daniel; Groh, Ann-Christin; Krausel, Vanessa; Lüttgenau, Simona Mareike; Amelung, Till Maximilian; Pavenstädt, Hermann; Weide, Thomas. Evolution of Renal-Disease Factor APOL1 Results in Cis and Trans Orientations at the Endoplasmic Reticulum That Both Show Cytotoxic Effects. Molecular Biology And Evolution. 2021;38(11):4962-4976. 

Galindo-Moreno, J; Iurlaro, R; El Mjiyad, N; Díez-Pérez, J; Gabaldón, T; Muñoz-Pinedo, C. Apolipoprotein L2 contains a BH3-like domain but it does not behave as a BH3-only protein. Cell Death & Disease. 2014;5(6):e1275.