Anti APOL1 pAb (ATL-HPA018885 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA018885-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: apolipoprotein L, 1
Gene Name: APOL1
Alternative Gene Name: APOL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010601: 43%, ENSRNOG00000047782: 39%
Entrez Gene ID: 8542
Uniprot ID: O14791
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SNFLSLAGNTYQLTRGIGKDIRALRRARANLQSVPHASASRPRVTEPISAESGEQVERVNEPSILEMSRGVKLTDVAPVSFFLVLDVVYLVYESKHLHEGAKSETAEELKKVAQELEEKLNILNN
Gene Sequence SNFLSLAGNTYQLTRGIGKDIRALRRARANLQSVPHASASRPRVTEPISAESGEQVERVNEPSILEMSRGVKLTDVAPVSFFLVLDVVYLVYESKHLHEGAKSETAEELKKVAQELEEKLNILNN
Gene ID - Mouse ENSMUSG00000010601
Gene ID - Rat ENSRNOG00000047782
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti APOL1 pAb (ATL-HPA018885 w/enhanced validation)
Datasheet Anti APOL1 pAb (ATL-HPA018885 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti APOL1 pAb (ATL-HPA018885 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti APOL1 pAb (ATL-HPA018885 w/enhanced validation)
Datasheet Anti APOL1 pAb (ATL-HPA018885 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti APOL1 pAb (ATL-HPA018885 w/enhanced validation)
Citations for Anti APOL1 pAb (ATL-HPA018885 w/enhanced validation) – 28 Found
Ma, Lijun; Shelness, Gregory S; Snipes, James A; Murea, Mariana; Antinozzi, Peter A; Cheng, Dongmei; Saleem, Moin A; Satchell, Simon C; Banas, Bernhard; Mathieson, Peter W; Kretzler, Matthias; Hemal, Ashok K; Rudel, Lawrence L; Petrovic, Snezana; Weckerle, Allison; Pollak, Martin R; Ross, Michael D; Parks, John S; Freedman, Barry I. Localization of APOL1 protein and mRNA in the human kidney: nondiseased tissue, primary cells, and immortalized cell lines. Journal Of The American Society Of Nephrology : Jasn. 2015;26(2):339-48.  PubMed
Khatua, Atanu K; Cheatham, Amber M; Kruzel, Etty D; Singhal, Pravin C; Skorecki, Karl; Popik, Waldemar. Exon 4-encoded sequence is a major determinant of cytotoxicity of apolipoprotein L1. American Journal Of Physiology. Cell Physiology. 2015;309(1):C22-37.  PubMed
Cheng, Dongmei; Weckerle, Allison; Yu, Yi; Ma, Lijun; Zhu, Xuewei; Murea, Mariana; Freedman, Barry I; Parks, John S; Shelness, Gregory S. Biogenesis and cytotoxicity of APOL1 renal risk variant proteins in hepatocytes and hepatoma cells. Journal Of Lipid Research. 2015;56(8):1583-93.  PubMed
Heneghan, J F; Vandorpe, D H; Shmukler, B E; Giovinazzo, J A; Raper, J; Friedman, D J; Pollak, M R; Alper, S L. BH3 domain-independent apolipoprotein L1 toxicity rescued by BCL2 prosurvival proteins. American Journal Of Physiology. Cell Physiology. 2015;309(5):C332-47.  PubMed
Kruzel-Davila, Etty; Shemer, Revital; Ofir, Ayala; Bavli-Kertselli, Ira; Darlyuk-Saadon, Ilona; Oren-Giladi, Pazit; Wasser, Walter G; Magen, Daniella; Zaknoun, Eid; Schuldiner, Maya; Salzberg, Adi; Kornitzer, Daniel; Marelja, Zvonimir; Simons, Matias; Skorecki, Karl. APOL1-Mediated Cell Injury Involves Disruption of Conserved Trafficking Processes. Journal Of The American Society Of Nephrology : Jasn. 2017;28(4):1117-1130.  PubMed
Hayek, Salim S; Koh, Kwi Hye; Grams, Morgan E; Wei, Changli; Ko, Yi-An; Li, Jing; Samelko, Beata; Lee, Hyun; Dande, Ranadheer R; Lee, Ha Won; Hahm, Eunsil; Peev, Vasil; Tracy, Melissa; Tardi, Nicholas J; Gupta, Vineet; Altintas, Mehmet M; Garborcauskas, Garrett; Stojanovic, Nikolina; Winkler, Cheryl A; Lipkowitz, Michael S; Tin, Adrienne; Inker, Lesley A; Levey, Andrew S; Zeier, Martin; Freedman, Barry I; Kopp, Jeffrey B; Skorecki, Karl; Coresh, Josef; Quyyumi, Arshed A; Sever, Sanja; Reiser, Jochen. A tripartite complex of suPAR, APOL1 risk variants and α(v)β(3) integrin on podocytes mediates chronic kidney disease. Nature Medicine. 2017;23(8):945-953.  PubMed
Granado, Daniel; Müller, Daria; Krausel, Vanessa; Kruzel-Davila, Etty; Schuberth, Christian; Eschborn, Melanie; Wedlich-Söldner, Roland; Skorecki, Karl; Pavenstädt, Hermann; Michgehl, Ulf; Weide, Thomas. Intracellular APOL1 Risk Variants Cause Cytotoxicity Accompanied by Energy Depletion. Journal Of The American Society Of Nephrology : Jasn. 2017;28(11):3227-3238.  PubMed
Fontaine, Frédéric; Lecordier, Laurence; Vanwalleghem, Gilles; Uzureau, Pierrick; Van Reet, Nick; Fontaine, Martina; Tebabi, Patricia; Vanhollebeke, Benoit; Büscher, Philippe; Pérez-Morga, David; Pays, Etienne. APOLs with low pH dependence can kill all African trypanosomes. Nature Microbiology. 2017;2(11):1500-1506.  PubMed
Okamoto, Koji; Rausch, Jason W; Wakashin, Hidefumi; Fu, Yulong; Chung, Joon-Yong; Dummer, Patrick D; Shin, Myung K; Chandra, Preeti; Suzuki, Kosuke; Shrivastav, Shashi; Rosenberg, Avi Z; Hewitt, Stephen M; Ray, Patricio E; Noiri, Eisei; Le Grice, Stuart F J; Hoek, Maarten; Han, Zhe; Winkler, Cheryl A; Kopp, Jeffrey B. APOL1 risk allele RNA contributes to renal toxicity by activating protein kinase R. Communications Biology. 1( 30417125):188.  PubMed
Chun, Justin; Zhang, Jia-Yue; Wilkins, Maris S; Subramanian, Balajikarthick; Riella, Cristian; Magraner, Jose M; Alper, Seth L; Friedman, David J; Pollak, Martin R. Recruitment of APOL1 kidney disease risk variants to lipid droplets attenuates cell toxicity. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2019;116(9):3712-3721.  PubMed
Ryu, Jung-Hwa; Ge, Mengyuan; Merscher, Sandra; Rosenberg, Avi Z; Desante, Marco; Roshanravan, Hila; Okamoto, Koji; Shin, Myung K; Hoek, Maarten; Fornoni, Alessia; Kopp, Jeffrey B. APOL1 renal risk variants promote cholesterol accumulation in tissues and cultured macrophages from APOL1 transgenic mice. Plos One. 14(4):e0211559.  PubMed
Scales, Suzie J; Gupta, Nidhi; De Mazière, Ann M; Posthuma, George; Chiu, Cecilia P; Pierce, Andrew A; Hötzel, Kathy; Tao, Jianhua; Foreman, Oded; Koukos, Georgios; Oltrabella, Francesca; Klumperman, Judith; Lin, WeiYu; Peterson, Andrew S. Apolipoprotein L1-Specific Antibodies Detect Endogenous APOL1 inside the Endoplasmic Reticulum and on the Plasma Membrane of Podocytes. Journal Of The American Society Of Nephrology : Jasn. 2020;31(9):2044-2064.  PubMed
Ge, Mengyuan; Molina, Judith; Ducasa, G Michelle; Mallela, Shamroop K; Varona Santos, Javier; Mitrofanova, Alla; Kim, Jin-Ju; Liu, Xiaochen; Sloan, Alexis; Mendez, Armando J; Banerjee, Santanu; Liu, Shaoyi; Szeto, Hazel H; Shin, Myung K; Hoek, Maarten; Kopp, Jeffrey B; Fontanesi, Flavia; Merscher, Sandra; Fornoni, Alessia. APOL1 risk variants affect podocyte lipid homeostasis and energy production in focal segmental glomerulosclerosis. Human Molecular Genetics. 2021;30(3-4):182-197.  PubMed
Blessing, Natalya A; Wu, Zhenzhen; Madhavan, Sethu M; Choy, Jonathan W; Chen, Michelle; Shin, Myung K; Hoek, Maarten; Sedor, John R; O'Toole, John F; Bruggeman, Leslie A. Lack of APOL1 in proximal tubules of normal human kidneys and proteinuric APOL1 transgenic mouse kidneys. Plos One. 16(6):e0253197.  PubMed
Müller, Daria; Schmitz, Jürgen; Fischer, Katharina; Granado, Daniel; Groh, Ann-Christin; Krausel, Vanessa; Lüttgenau, Simona Mareike; Amelung, Till Maximilian; Pavenstädt, Hermann; Weide, Thomas. Evolution of Renal-Disease Factor APOL1 Results in Cis and Trans Orientations at the Endoplasmic Reticulum That Both Show Cytotoxic Effects. Molecular Biology And Evolution. 2021;38(11):4962-4976.  PubMed
Kruzel-Davila, Etty; Bavli-Kertselli, Ira; Ofir, Ayala; Cheatham, Amber M; Shemer, Revital; Zaknoun, Eid; Chornyy, Sergiy; Tabachnikov, Orly; Davis, Shamara E; Khatua, Atanu K; Skorecki, Karl; Popik, Waldemar. Endoplasmic reticulum-translocation is essential for APOL1 cellular toxicity. Iscience. 2022;25(1):103717.  PubMed
Tzukerman, Maty; Shamai, Yeela; Abramovich, Ifat; Gottlieb, Eyal; Selig, Sara; Skorecki, Karl. Comparative Analysis of the APOL1 Variants in the Genetic Landscape of Renal Carcinoma Cells. Cancers. 2022;14(3)  PubMed
Madhavan, Sethu M; O'Toole, John F; Konieczkowski, Martha; Ganesan, Santhi; Bruggeman, Leslie A; Sedor, John R. APOL1 localization in normal kidney and nondiabetic kidney disease. Journal Of The American Society Of Nephrology : Jasn. 2011;22(11):2119-28.  PubMed
Johnstone, Duncan B; Shegokar, Vijay; Nihalani, Deepak; Rathore, Yogendra Singh; Mallik, Leena; Ashish; Zare, Vasant; Ikizler, H Omer; Powar, Rajaram; Holzman, Lawrence B. APOL1 null alleles from a rural village in India do not correlate with glomerulosclerosis. Plos One. 7(12):e51546.  PubMed
Beckerman, Pazit; Bi-Karchin, Jing; Park, Ae Seo Deok; Qiu, Chengxiang; Dummer, Patrick D; Soomro, Irfana; Boustany-Kari, Carine M; Pullen, Steven S; Miner, Jeffrey H; Hu, Chien-An A; Rohacs, Tibor; Inoue, Kazunori; Ishibe, Shuta; Saleem, Moin A; Palmer, Matthew B; Cuervo, Ana Maria; Kopp, Jeffrey B; Susztak, Katalin. Transgenic expression of human APOL1 risk variants in podocytes induces kidney disease in mice. Nature Medicine. 2017;23(4):429-438.  PubMed
Skorecki, Karl L; Lee, Jessica H; Langefeld, Carl D; Rosset, Saharon; Tzur, Shay; Wasser, Walter G; Shemer, Revital; Hawkins, Gregory A; Divers, Jasmin; Parekh, Rulan S; Li, Man; Sampson, Matthew G; Kretzler, Matthias; Pollak, Martin R; Shah, Shrijal; Blackler, Daniel; Nichols, Brendan; Wilmot, Michael; Alper, Seth L; Freedman, Barry I; Friedman, David J. A null variant in the apolipoprotein L3 gene is associated with non-diabetic nephropathy. Nephrology, Dialysis, Transplantation : Official Publication Of The European Dialysis And Transplant Association - European Renal Association. 2018;33(2):323-330.  PubMed
Cheatham, Amber M; Davis, Shamara E; Khatua, Atanu K; Popik, Waldemar. Blocking the 5' splice site of exon 4 by a morpholino oligomer triggers APOL1 protein isoform switch. Scientific Reports. 2018;8(1):8739.  PubMed
Aghajan, Mariam; Booten, Sheri L; Althage, Magnus; Hart, Christopher E; Ericsson, Anette; Maxvall, Ingela; Ochaba, Joseph; Menschik-Lundin, Angela; Hartleib, Judith; Kuntz, Steven; Gattis, Danielle; Ahlström, Christine; Watt, Andrew T; Engelhardt, Jeffery A; Monia, Brett P; Magnone, Maria Chiara; Guo, Shuling. Antisense oligonucleotide treatment ameliorates IFN-γ-induced proteinuria in APOL1-transgenic mice. Jci Insight. 2019;4(12)  PubMed
Shah, Shrijal S; Lannon, Herbert; Dias, Leny; Zhang, Jia-Yue; Alper, Seth L; Pollak, Martin R; Friedman, David J. APOL1 Kidney Risk Variants Induce Cell Death via Mitochondrial Translocation and Opening of the Mitochondrial Permeability Transition Pore. Journal Of The American Society Of Nephrology : Jasn. 2019;30(12):2355-2368.  PubMed
Davis, Shamara E; Khatua, Atanu K; Popik, Waldemar. Nucleosomal dsDNA Stimulates APOL1 Expression in Human Cultured Podocytes by Activating the cGAS/IFI16-STING Signaling Pathway. Scientific Reports. 2019;9(1):15485.  PubMed
Uzureau, Sophie; Lecordier, Laurence; Uzureau, Pierrick; Hennig, Dorle; Graversen, Jonas H; Homblé, Fabrice; Mfutu, Pepe Ekulu; Oliveira Arcolino, Fanny; Ramos, Ana Raquel; La Rovere, Rita M; Luyten, Tomas; Vermeersch, Marjorie; Tebabi, Patricia; Dieu, Marc; Cuypers, Bart; Deborggraeve, Stijn; Rabant, Marion; Legendre, Christophe; Moestrup, Søren K; Levtchenko, Elena; Bultynck, Geert; Erneux, Christophe; Pérez-Morga, David; Pays, Etienne. APOL1 C-Terminal Variants May Trigger Kidney Disease through Interference with APOL3 Control of Actomyosin. Cell Reports. 2020;30(11):3821-3836.e13.  PubMed
Liu, Esther; Radmanesh, Behram; Chung, Byungha H; Donnan, Michael D; Yi, Dan; Dadi, Amal; Smith, Kelly D; Himmelfarb, Jonathan; Li, Mingyao; Freedman, Benjamin S; Lin, Jennie. Profiling APOL1 Nephropathy Risk Variants in Genome-Edited Kidney Organoids with Single-Cell Transcriptomics. Kidney360. 2020;1(3):203-215.  PubMed
McCarthy, Gizelle M; Blasio, Angelo; Donovan, Olivia G; Schaller, Lena B; Bock-Hughes, Althea; Magraner, Jose M; Suh, Jung Hee; Tattersfield, Calum F; Stillman, Isaac E; Shah, Shrijal S; Zsengeller, Zsuzsanna K; Subramanian, Balajikarthick; Friedman, David J; Pollak, Martin R. Recessive, gain-of-function toxicity in an APOL1 BAC transgenic mouse model mirrors human APOL1 kidney disease. Disease Models & Mechanisms. 2021;14(8)  PubMed