Anti APOH pAb (ATL-HPA003732 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA003732-100
- Shipping:
- Calculated at Checkout
$554.00
Gene Name: APOH
Alternative Gene Name: B2G1, BG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000049: 74%, ENSRNOG00000003566: 78%
Entrez Gene ID: 350
Uniprot ID: P02749
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITC |
| Gene Sequence | EPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITC |
| Gene ID - Mouse | ENSMUSG00000000049 |
| Gene ID - Rat | ENSRNOG00000003566 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti APOH pAb (ATL-HPA003732 w/enhanced validation) | |
| Datasheet | Anti APOH pAb (ATL-HPA003732 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti APOH pAb (ATL-HPA003732 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti APOH pAb (ATL-HPA003732 w/enhanced validation) | |
| Datasheet | Anti APOH pAb (ATL-HPA003732 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti APOH pAb (ATL-HPA003732 w/enhanced validation) |
| Citations for Anti APOH pAb (ATL-HPA003732 w/enhanced validation) – 4 Found |
| Kato, Bernet S; Nicholson, George; Neiman, Maja; Rantalainen, Mattias; Holmes, Chris C; Barrett, Amy; Uhlén, Mathias; Nilsson, Peter; Spector, Tim D; Schwenk, Jochen M. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Science. 2011;9( 22093360):73. PubMed |
| Sá E Cunha, Cláudia; Nyboer, Britta; Heiss, Kirsten; Sanches-Vaz, Margarida; Fontinha, Diana; Wiedtke, Ellen; Grimm, Dirk; Przyborski, Jude Marek; Mota, Maria M; Prudêncio, Miguel; Mueller, Ann-Kristin. Plasmodium berghei EXP-1 interacts with host Apolipoprotein H during Plasmodium liver-stage development. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2017;114(7):E1138-E1147. PubMed |
| Wolanin, Kamil; Fontinha, Diana; Sanches-Vaz, Margarida; Nyboer, Britta; Heiss, Kirsten; Mueller, Ann-Kristin; Prudêncio, Miguel. A crucial role for the C-terminal domain of exported protein 1 during the mosquito and hepatic stages of the Plasmodium berghei life cycle. Cellular Microbiology. 2019;21(10):e13088. PubMed |
| Park, Jihye; Jeong, Daeun; Chung, Youn Wook; Han, Seunghan; Kim, Da Hye; Yu, Jongwook; Cheon, Jae Hee; Ryu, Ji-Hwan. Proteomic analysis-based discovery of a novel biomarker that differentiates intestinal Behçet's disease from Crohn's disease. Scientific Reports. 2021;11(1):11019. PubMed |