Anti APOH pAb (ATL-HPA003732 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA003732-100
Shipping:
Calculated at Checkout
$554.00
Adding to cart… The item has been added
Protein Description: apolipoprotein H (beta-2-glycoprotein I)
Gene Name: APOH
Alternative Gene Name: B2G1, BG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000049: 74%, ENSRNOG00000003566: 78%
Entrez Gene ID: 350
Uniprot ID: P02749
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITC
Gene Sequence EPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITC
Gene ID - Mouse ENSMUSG00000000049
Gene ID - Rat ENSRNOG00000003566
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti APOH pAb (ATL-HPA003732 w/enhanced validation)
Datasheet Anti APOH pAb (ATL-HPA003732 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti APOH pAb (ATL-HPA003732 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti APOH pAb (ATL-HPA003732 w/enhanced validation)
Datasheet Anti APOH pAb (ATL-HPA003732 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti APOH pAb (ATL-HPA003732 w/enhanced validation)
Citations for Anti APOH pAb (ATL-HPA003732 w/enhanced validation) – 4 Found
Kato, Bernet S; Nicholson, George; Neiman, Maja; Rantalainen, Mattias; Holmes, Chris C; Barrett, Amy; Uhlén, Mathias; Nilsson, Peter; Spector, Tim D; Schwenk, Jochen M. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Science. 2011;9( 22093360):73.  PubMed
Sá E Cunha, Cláudia; Nyboer, Britta; Heiss, Kirsten; Sanches-Vaz, Margarida; Fontinha, Diana; Wiedtke, Ellen; Grimm, Dirk; Przyborski, Jude Marek; Mota, Maria M; Prudêncio, Miguel; Mueller, Ann-Kristin. Plasmodium berghei EXP-1 interacts with host Apolipoprotein H during Plasmodium liver-stage development. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2017;114(7):E1138-E1147.  PubMed
Wolanin, Kamil; Fontinha, Diana; Sanches-Vaz, Margarida; Nyboer, Britta; Heiss, Kirsten; Mueller, Ann-Kristin; Prudêncio, Miguel. A crucial role for the C-terminal domain of exported protein 1 during the mosquito and hepatic stages of the Plasmodium berghei life cycle. Cellular Microbiology. 2019;21(10):e13088.  PubMed
Park, Jihye; Jeong, Daeun; Chung, Youn Wook; Han, Seunghan; Kim, Da Hye; Yu, Jongwook; Cheon, Jae Hee; Ryu, Ji-Hwan. Proteomic analysis-based discovery of a novel biomarker that differentiates intestinal Behçet's disease from Crohn's disease. Scientific Reports. 2021;11(1):11019.  PubMed