Anti APOH pAb (ATL-HPA001654 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA001654-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: apolipoprotein H (beta-2-glycoprotein I)
Gene Name: APOH
Alternative Gene Name: B2G1, BG
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000049: 76%, ENSRNOG00000003566: 85%
Entrez Gene ID: 350
Uniprot ID: P02749
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFSKTDASDVK
Gene Sequence ECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFSKTDASDVK
Gene ID - Mouse ENSMUSG00000000049
Gene ID - Rat ENSRNOG00000003566
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti APOH pAb (ATL-HPA001654 w/enhanced validation)
Datasheet Anti APOH pAb (ATL-HPA001654 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti APOH pAb (ATL-HPA001654 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti APOH pAb (ATL-HPA001654 w/enhanced validation)
Datasheet Anti APOH pAb (ATL-HPA001654 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti APOH pAb (ATL-HPA001654 w/enhanced validation)
Citations for Anti APOH pAb (ATL-HPA001654 w/enhanced validation) – 4 Found
Tanimura, Kenji; Jin, Hui; Suenaga, Tadahiro; Morikami, Satoko; Arase, Noriko; Kishida, Kazuki; Hirayasu, Kouyuki; Kohyama, Masako; Ebina, Yasuhiko; Yasuda, Shinsuke; Horita, Tetsuya; Takasugi, Kiyoshi; Ohmura, Koichiro; Yamamoto, Ken; Katayama, Ichiro; Sasazuki, Takehiko; Lanier, Lewis L; Atsumi, Tatsuya; Yamada, Hideto; Arase, Hisashi. β2-Glycoprotein I/HLA class II complexes are novel autoantigens in antiphospholipid syndrome. Blood. 2015;125(18):2835-44.  PubMed
Häggmark, Anna; Neiman, Maja; Drobin, Kimi; Zwahlen, Martin; Uhlén, Mathias; Nilsson, Peter; Schwenk, Jochen M. Classification of protein profiles from antibody microarrays using heat and detergent treatment. New Biotechnology. 2012;29(5):564-70.  PubMed
Kato, Bernet S; Nicholson, George; Neiman, Maja; Rantalainen, Mattias; Holmes, Chris C; Barrett, Amy; Uhlén, Mathias; Nilsson, Peter; Spector, Tim D; Schwenk, Jochen M. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Science. 2011;9( 22093360):73.  PubMed
Zhang, Guiting; Cai, Qianqian; Zhou, Hong; He, Chao; Chen, Yudan; Zhang, Peng; Wang, Ting; Xu, Liangjie; Yan, Jinchuan. OxLDL/β2GPI/anti‑β2GPI Ab complex induces inflammatory activation via the TLR4/NF‑κB pathway in HUVECs. Molecular Medicine Reports. 2021;23(2)  PubMed