Anti APOC4 pAb (ATL-HPA062671)
Atlas Antibodies
- SKU:
- ATL-HPA062671-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: APOC4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074336: 69%, ENSRNOG00000018405: 69%
Entrez Gene ID: 346
Uniprot ID: P55056
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QTYYDDHLRDLGPLTKAWFLESKDSLLKKTHSLCPRLVCGDKDQG |
Gene Sequence | QTYYDDHLRDLGPLTKAWFLESKDSLLKKTHSLCPRLVCGDKDQG |
Gene ID - Mouse | ENSMUSG00000074336 |
Gene ID - Rat | ENSRNOG00000018405 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti APOC4 pAb (ATL-HPA062671) | |
Datasheet | Anti APOC4 pAb (ATL-HPA062671) Datasheet (External Link) |
Vendor Page | Anti APOC4 pAb (ATL-HPA062671) at Atlas Antibodies |
Documents & Links for Anti APOC4 pAb (ATL-HPA062671) | |
Datasheet | Anti APOC4 pAb (ATL-HPA062671) Datasheet (External Link) |
Vendor Page | Anti APOC4 pAb (ATL-HPA062671) |