Anti APOC4 pAb (ATL-HPA062671)

Atlas Antibodies

SKU:
ATL-HPA062671-25
  • Immunohistochemical staining of human kidney shows moderate membranous positivity in cells in tubules along with distinctly stained extracellular material/ Plasma.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: apolipoprotein C-IV
Gene Name: APOC4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074336: 69%, ENSRNOG00000018405: 69%
Entrez Gene ID: 346
Uniprot ID: P55056
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QTYYDDHLRDLGPLTKAWFLESKDSLLKKTHSLCPRLVCGDKDQG
Gene Sequence QTYYDDHLRDLGPLTKAWFLESKDSLLKKTHSLCPRLVCGDKDQG
Gene ID - Mouse ENSMUSG00000074336
Gene ID - Rat ENSRNOG00000018405
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti APOC4 pAb (ATL-HPA062671)
Datasheet Anti APOC4 pAb (ATL-HPA062671) Datasheet (External Link)
Vendor Page Anti APOC4 pAb (ATL-HPA062671) at Atlas Antibodies

Documents & Links for Anti APOC4 pAb (ATL-HPA062671)
Datasheet Anti APOC4 pAb (ATL-HPA062671) Datasheet (External Link)
Vendor Page Anti APOC4 pAb (ATL-HPA062671)