Anti APOC2 pAb (ATL-HPA055877)

Atlas Antibodies

Catalog No.:
ATL-HPA055877-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: apolipoprotein C-II
Gene Name: APOC2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000109350: 70%, ENSRNOG00000018402: 75%
Entrez Gene ID: 344
Uniprot ID: P02655
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE
Gene Sequence TYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE
Gene ID - Mouse ENSMUSG00000109350
Gene ID - Rat ENSRNOG00000018402
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti APOC2 pAb (ATL-HPA055877)
Datasheet Anti APOC2 pAb (ATL-HPA055877) Datasheet (External Link)
Vendor Page Anti APOC2 pAb (ATL-HPA055877) at Atlas Antibodies

Documents & Links for Anti APOC2 pAb (ATL-HPA055877)
Datasheet Anti APOC2 pAb (ATL-HPA055877) Datasheet (External Link)
Vendor Page Anti APOC2 pAb (ATL-HPA055877)