Anti APOC2 pAb (ATL-HPA055877)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055877-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: APOC2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000109350: 70%, ENSRNOG00000018402: 75%
Entrez Gene ID: 344
Uniprot ID: P02655
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE |
Gene Sequence | TYLPAVDEKLRDLYSKSTAAMSTYTGIFTDQVLSVLKGEE |
Gene ID - Mouse | ENSMUSG00000109350 |
Gene ID - Rat | ENSRNOG00000018402 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti APOC2 pAb (ATL-HPA055877) | |
Datasheet | Anti APOC2 pAb (ATL-HPA055877) Datasheet (External Link) |
Vendor Page | Anti APOC2 pAb (ATL-HPA055877) at Atlas Antibodies |
Documents & Links for Anti APOC2 pAb (ATL-HPA055877) | |
Datasheet | Anti APOC2 pAb (ATL-HPA055877) Datasheet (External Link) |
Vendor Page | Anti APOC2 pAb (ATL-HPA055877) |