Anti APOC1 pAb (ATL-HPA051518)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051518-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: APOC1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040564: 65%, ENSRNOG00000051439: 65%
Entrez Gene ID: 341
Uniprot ID: P02654
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKE |
Gene Sequence | PDVSSALDKLKEFGNTLEDKARELISRIKQSELSAKMREWFSETFQKVKE |
Gene ID - Mouse | ENSMUSG00000040564 |
Gene ID - Rat | ENSRNOG00000051439 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti APOC1 pAb (ATL-HPA051518) | |
Datasheet | Anti APOC1 pAb (ATL-HPA051518) Datasheet (External Link) |
Vendor Page | Anti APOC1 pAb (ATL-HPA051518) at Atlas Antibodies |
Documents & Links for Anti APOC1 pAb (ATL-HPA051518) | |
Datasheet | Anti APOC1 pAb (ATL-HPA051518) Datasheet (External Link) |
Vendor Page | Anti APOC1 pAb (ATL-HPA051518) |
Citations for Anti APOC1 pAb (ATL-HPA051518) – 2 Found |
Evangelou, Petros; Groll, Mathias; Oppermann, Henry; Gaunitz, Frank; Eisenlöffel, Christian; Müller, Wolf; Eschrich, Klaus; Schänzer, Anne; Nestler, Ulf. Assessment of ApoC1, LuzP6, C12orf75 and OCC-1 in cystic glioblastoma using MALDI-TOF mass spectrometry, immunohistochemistry and qRT-PCR. Medical Molecular Morphology. 2019;52(4):217-225. PubMed |
Lind, Anne-Li; Just, David; Mikus, Maria; Fredolini, Claudia; Ioannou, Marina; Gerdle, Björn; Ghafouri, Bijar; Bäckryd, Emmanuel; Tanum, Lars; Gordh, Torsten; Månberg, Anna. CSF levels of apolipoprotein C1 and autotaxin found to associate with neuropathic pain and fibromyalgia. Journal Of Pain Research. 12( 31686904):2875-2889. PubMed |