Anti APOBEC3H pAb (ATL-HPA021492)

Atlas Antibodies

Catalog No.:
ATL-HPA021492-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3H
Gene Name: APOBEC3H
Alternative Gene Name: ARP10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000009585: 48%, ENSRNOG00000016852: 51%
Entrez Gene ID: 164668
Uniprot ID: Q6NTF7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CSSCAWELVDFIKAHDHLNLGIFASRLYYHWCKPQQKGLRLLCGSQVPVEVMGFPEFADCWENFVDHEKPLSFNPYKMLEELDKNSRAIKRRLERIKQS
Gene Sequence CSSCAWELVDFIKAHDHLNLGIFASRLYYHWCKPQQKGLRLLCGSQVPVEVMGFPEFADCWENFVDHEKPLSFNPYKMLEELDKNSRAIKRRLERIKQS
Gene ID - Mouse ENSMUSG00000009585
Gene ID - Rat ENSRNOG00000016852
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti APOBEC3H pAb (ATL-HPA021492)
Datasheet Anti APOBEC3H pAb (ATL-HPA021492) Datasheet (External Link)
Vendor Page Anti APOBEC3H pAb (ATL-HPA021492) at Atlas Antibodies

Documents & Links for Anti APOBEC3H pAb (ATL-HPA021492)
Datasheet Anti APOBEC3H pAb (ATL-HPA021492) Datasheet (External Link)
Vendor Page Anti APOBEC3H pAb (ATL-HPA021492)