Anti APOBEC3H pAb (ATL-HPA021492)

Atlas Antibodies

Catalog No.: ATL-HPA021492-25

Protein Description: apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3H
Gene Name: APOBEC3H
Alternative Gene Name: ARP10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000009585: 48%, ENSRNOG00000016852: 51%
Entrez Gene ID: 164668
Uniprot ID: Q6NTF7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CSSCAWELVDFIKAHDHLNLGIFASRLYYHWCKPQQKGLRLLCGSQVPVEVMGFPEFADCWENFVDHEKPLSFNPYKMLEELDKNSRAIKRRLERIKQS
• Gene Sequence: CSSCAWELVDFIKAHDHLNLGIFASRLYYHWCKPQQKGLRLLCGSQVPVEVMGFPEFADCWENFVDHEKPLSFNPYKMLEELDKNSRAIKRRLERIKQS
• Gene ID - Mouse: ENSMUSG00000009585
• Gene ID - Rat: ENSRNOG00000016852
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.