Anti APOBEC2 pAb (ATL-HPA014252)

Atlas Antibodies

SKU:
ATL-HPA014252-25
  • Immunohistochemical staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 2
Gene Name: APOBEC2
Alternative Gene Name: ARCD1, ARP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040694: 90%, ENSRNOG00000012303: 92%
Entrez Gene ID: 10930
Uniprot ID: Q9Y235
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DDPEKLKELIELPPFEIVTGERLPANFFKFQFRNVEYSSGRNKTFLCYVVEAQGKGGQVQASRGYLEDEHAAAHAEEAFFNTILPAFDPALRYNVTWYVSSSPCAACADRIIKTLSKTKNLRLLI
Gene Sequence DDPEKLKELIELPPFEIVTGERLPANFFKFQFRNVEYSSGRNKTFLCYVVEAQGKGGQVQASRGYLEDEHAAAHAEEAFFNTILPAFDPALRYNVTWYVSSSPCAACADRIIKTLSKTKNLRLLI
Gene ID - Mouse ENSMUSG00000040694
Gene ID - Rat ENSRNOG00000012303
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti APOBEC2 pAb (ATL-HPA014252)
Datasheet Anti APOBEC2 pAb (ATL-HPA014252) Datasheet (External Link)
Vendor Page Anti APOBEC2 pAb (ATL-HPA014252) at Atlas Antibodies

Documents & Links for Anti APOBEC2 pAb (ATL-HPA014252)
Datasheet Anti APOBEC2 pAb (ATL-HPA014252) Datasheet (External Link)
Vendor Page Anti APOBEC2 pAb (ATL-HPA014252)