Anti APOA4 pAb (ATL-HPA002549 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA002549-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: apolipoprotein A-IV
Gene Name: APOA4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032080: 51%, ENSRNOG00000055909: 48%
Entrez Gene ID: 337
Uniprot ID: P06727
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DKLGEVNTYAGDLQKKLVPFATELHERLAKDSEKLKEEIGKELEELRARLLPHANEVSQKIGDNLRELQQRLEPYADQLRTQVNTQAEQLRRQLTPYAQRMERVLRENADSLQASLRPHADELKAKIDQNVEELKGRLTPYADEFKVK
Gene Sequence DKLGEVNTYAGDLQKKLVPFATELHERLAKDSEKLKEEIGKELEELRARLLPHANEVSQKIGDNLRELQQRLEPYADQLRTQVNTQAEQLRRQLTPYAQRMERVLRENADSLQASLRPHADELKAKIDQNVEELKGRLTPYADEFKVK
Gene ID - Mouse ENSMUSG00000032080
Gene ID - Rat ENSRNOG00000055909
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti APOA4 pAb (ATL-HPA002549 w/enhanced validation)
Datasheet Anti APOA4 pAb (ATL-HPA002549 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti APOA4 pAb (ATL-HPA002549 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti APOA4 pAb (ATL-HPA002549 w/enhanced validation)
Datasheet Anti APOA4 pAb (ATL-HPA002549 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti APOA4 pAb (ATL-HPA002549 w/enhanced validation)
Citations for Anti APOA4 pAb (ATL-HPA002549 w/enhanced validation) – 2 Found
Kato, Bernet S; Nicholson, George; Neiman, Maja; Rantalainen, Mattias; Holmes, Chris C; Barrett, Amy; Uhlén, Mathias; Nilsson, Peter; Spector, Tim D; Schwenk, Jochen M. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Science. 2011;9( 22093360):73.  PubMed
Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476.  PubMed