Anti APOA4 pAb (ATL-HPA001352 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA001352-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: APOA4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032080: 65%, ENSRNOG00000055909: 63%
Entrez Gene ID: 337
Uniprot ID: P06727
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LEGLTFQMKKNAEELKARISASAEELRQRLAPLAEDVRGNLRGNTEGLQKSLAELGGHLDQQVEEFRRRVEPYGENFNKALVQQMEQLRQKLGPHAGDVEGHLSFLEKDLRDKVNSFFSTFKEKESQDKTLSLP |
| Gene Sequence | LEGLTFQMKKNAEELKARISASAEELRQRLAPLAEDVRGNLRGNTEGLQKSLAELGGHLDQQVEEFRRRVEPYGENFNKALVQQMEQLRQKLGPHAGDVEGHLSFLEKDLRDKVNSFFSTFKEKESQDKTLSLP |
| Gene ID - Mouse | ENSMUSG00000032080 |
| Gene ID - Rat | ENSRNOG00000055909 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti APOA4 pAb (ATL-HPA001352 w/enhanced validation) | |
| Datasheet | Anti APOA4 pAb (ATL-HPA001352 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti APOA4 pAb (ATL-HPA001352 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti APOA4 pAb (ATL-HPA001352 w/enhanced validation) | |
| Datasheet | Anti APOA4 pAb (ATL-HPA001352 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti APOA4 pAb (ATL-HPA001352 w/enhanced validation) |
| Citations for Anti APOA4 pAb (ATL-HPA001352 w/enhanced validation) – 5 Found |
| Mistry, Hiten D; Kurlak, Lesia O; Mansour, Yosef T; Zurkinden, Line; Mohaupt, Markus G; Escher, Geneviève. Increased maternal and fetal cholesterol efflux capacity and placental CYP27A1 expression in preeclampsia. Journal Of Lipid Research. 2017;58(6):1186-1195. PubMed |
| Levin, Y; Wang, L; Schwarz, E; Koethe, D; Leweke, F M; Bahn, S. Global proteomic profiling reveals altered proteomic signature in schizophrenia serum. Molecular Psychiatry. 2010;15(11):1088-100. PubMed |
| Kato, Bernet S; Nicholson, George; Neiman, Maja; Rantalainen, Mattias; Holmes, Chris C; Barrett, Amy; Uhlén, Mathias; Nilsson, Peter; Spector, Tim D; Schwenk, Jochen M. Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model. Proteome Science. 2011;9( 22093360):73. PubMed |
| Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. PubMed |
| Loberman-Nachum, Nurit; Sosnovski, Katya; Di Segni, Ayelet; Efroni, Gilat; Braun, Tzipi; BenShoshan, Marina; Anafi, Lait; Avivi, Camila; Barshack, Iris; Shouval, Dror S; Denson, Lee A; Amir, Amnon; Unger, Ron; Weiss, Batia; Haberman, Yael. Defining the Celiac Disease Transcriptome using Clinical Pathology Specimens Reveals Biologic Pathways and Supports Diagnosis. Scientific Reports. 2019;9(1):16163. PubMed |