Anti APOA2 pAb (ATL-HPA072575)
Atlas Antibodies
- Catalog No.:
- ATL-HPA072575-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: APOA2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005681: 63%, ENSRNOG00000003500: 63%
Entrez Gene ID: 336
Uniprot ID: P02652
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSY |
Gene Sequence | ALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSY |
Gene ID - Mouse | ENSMUSG00000005681 |
Gene ID - Rat | ENSRNOG00000003500 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti APOA2 pAb (ATL-HPA072575) | |
Datasheet | Anti APOA2 pAb (ATL-HPA072575) Datasheet (External Link) |
Vendor Page | Anti APOA2 pAb (ATL-HPA072575) at Atlas Antibodies |
Documents & Links for Anti APOA2 pAb (ATL-HPA072575) | |
Datasheet | Anti APOA2 pAb (ATL-HPA072575) Datasheet (External Link) |
Vendor Page | Anti APOA2 pAb (ATL-HPA072575) |