Anti APOA2 pAb (ATL-HPA072575)

Atlas Antibodies

Catalog No.:
ATL-HPA072575-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: apolipoprotein A2
Gene Name: APOA2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005681: 63%, ENSRNOG00000003500: 63%
Entrez Gene ID: 336
Uniprot ID: P02652
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSY
Gene Sequence ALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSY
Gene ID - Mouse ENSMUSG00000005681
Gene ID - Rat ENSRNOG00000003500
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti APOA2 pAb (ATL-HPA072575)
Datasheet Anti APOA2 pAb (ATL-HPA072575) Datasheet (External Link)
Vendor Page Anti APOA2 pAb (ATL-HPA072575) at Atlas Antibodies

Documents & Links for Anti APOA2 pAb (ATL-HPA072575)
Datasheet Anti APOA2 pAb (ATL-HPA072575) Datasheet (External Link)
Vendor Page Anti APOA2 pAb (ATL-HPA072575)