Anti APMAP pAb (ATL-HPA064700)

Atlas Antibodies

SKU:
ATL-HPA064700-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to plasma membrane.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: adipocyte plasma membrane associated protein
Gene Name: APMAP
Alternative Gene Name: BSCv, C20orf3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033096: 93%, ENSRNOG00000006795: 93%
Entrez Gene ID: 57136
Uniprot ID: Q9HDC9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SETPIEGKNMSFVNDLTVTQDGRKIYFTDSSSKWQRRDYLLLVMEGTDDGRLLEYDTVTREVKVLLDQLRFPNGVQLSPAEDFVLVAE
Gene Sequence SETPIEGKNMSFVNDLTVTQDGRKIYFTDSSSKWQRRDYLLLVMEGTDDGRLLEYDTVTREVKVLLDQLRFPNGVQLSPAEDFVLVAE
Gene ID - Mouse ENSMUSG00000033096
Gene ID - Rat ENSRNOG00000006795
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti APMAP pAb (ATL-HPA064700)
Datasheet Anti APMAP pAb (ATL-HPA064700) Datasheet (External Link)
Vendor Page Anti APMAP pAb (ATL-HPA064700) at Atlas Antibodies

Documents & Links for Anti APMAP pAb (ATL-HPA064700)
Datasheet Anti APMAP pAb (ATL-HPA064700) Datasheet (External Link)
Vendor Page Anti APMAP pAb (ATL-HPA064700)