Anti APMAP pAb (ATL-HPA012863)

Atlas Antibodies

SKU: ATL-HPA012863-100

• 
• 

Protein Description: adipocyte plasma membrane associated protein
Gene Name: APMAP
Alternative Gene Name: BSCv, C20orf3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033096: 89%, ENSRNOG00000006795: 87%
Entrez Gene ID: 57136
Uniprot ID: Q9HDC9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PLSFKEPPLLLGVLHPNTKLRQAERLFENQLVGPESIAHIGDVMFTGTADGRVVKLENGEIETIARFGSGPCKTRDDEPVCGRPLGIRAGPNGTLFVADAYKGLFEVNPWKREVKLLL
• Gene Sequence: PLSFKEPPLLLGVLHPNTKLRQAERLFENQLVGPESIAHIGDVMFTGTADGRVVKLENGEIETIARFGSGPCKTRDDEPVCGRPLGIRAGPNGTLFVADAYKGLFEVNPWKREVKLLL
• Gene ID - Mouse: ENSMUSG00000033096
• Gene ID - Rat: ENSRNOG00000006795
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti APMAP pAb (ATL-HPA012863) – 2 Found

Gerber, Hermeto; Mosser, Sebastien; Boury-Jamot, Benjamin; Stumpe, Michael; Piersigilli, Alessandra; Goepfert, Christine; Dengjel, Joern; Albrecht, Urs; Magara, Fulvio; Fraering, Patrick C. The APMAP interactome reveals new modulators of APP processing and beta-amyloid production that are altered in Alzheimer's disease. Acta Neuropathologica Communications. 2019;7(1):13. 

Haley, Sheila A; O'Hara, Bethany A; Atwood, Walter J. Adipocyte Plasma Membrane Protein (APMAP) promotes JC Virus (JCPyV) infection in human glial cells. Virology. 2020;548( 32838939):17-24.