Anti APMAP pAb (ATL-HPA012863)
Atlas Antibodies
- Catalog No.:
- ATL-HPA012863-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: APMAP
Alternative Gene Name: BSCv, C20orf3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033096: 89%, ENSRNOG00000006795: 87%
Entrez Gene ID: 57136
Uniprot ID: Q9HDC9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PLSFKEPPLLLGVLHPNTKLRQAERLFENQLVGPESIAHIGDVMFTGTADGRVVKLENGEIETIARFGSGPCKTRDDEPVCGRPLGIRAGPNGTLFVADAYKGLFEVNPWKREVKLLL |
| Gene Sequence | PLSFKEPPLLLGVLHPNTKLRQAERLFENQLVGPESIAHIGDVMFTGTADGRVVKLENGEIETIARFGSGPCKTRDDEPVCGRPLGIRAGPNGTLFVADAYKGLFEVNPWKREVKLLL |
| Gene ID - Mouse | ENSMUSG00000033096 |
| Gene ID - Rat | ENSRNOG00000006795 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti APMAP pAb (ATL-HPA012863) | |
| Datasheet | Anti APMAP pAb (ATL-HPA012863) Datasheet (External Link) |
| Vendor Page | Anti APMAP pAb (ATL-HPA012863) at Atlas Antibodies |
| Documents & Links for Anti APMAP pAb (ATL-HPA012863) | |
| Datasheet | Anti APMAP pAb (ATL-HPA012863) Datasheet (External Link) |
| Vendor Page | Anti APMAP pAb (ATL-HPA012863) |
| Citations for Anti APMAP pAb (ATL-HPA012863) – 2 Found |
| Gerber, Hermeto; Mosser, Sebastien; Boury-Jamot, Benjamin; Stumpe, Michael; Piersigilli, Alessandra; Goepfert, Christine; Dengjel, Joern; Albrecht, Urs; Magara, Fulvio; Fraering, Patrick C. The APMAP interactome reveals new modulators of APP processing and beta-amyloid production that are altered in Alzheimer's disease. Acta Neuropathologica Communications. 2019;7(1):13. PubMed |
| Haley, Sheila A; O'Hara, Bethany A; Atwood, Walter J. Adipocyte Plasma Membrane Protein (APMAP) promotes JC Virus (JCPyV) infection in human glial cells. Virology. 2020;548( 32838939):17-24. PubMed |