Anti APLP2 pAb (ATL-HPA039319)
Atlas Antibodies
- Catalog No.:
- ATL-HPA039319-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: APLP2
Alternative Gene Name: APPH, APPL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031996: 93%, ENSRNOG00000047179: 95%
Entrez Gene ID: 334
Uniprot ID: Q06481
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PYVAQEIQEEIDELLQEQRADMDQFTASISETPVDVRVSSEESEEIPPFHPFHPFPALPENEDTQPELYHPMK |
Gene Sequence | PYVAQEIQEEIDELLQEQRADMDQFTASISETPVDVRVSSEESEEIPPFHPFHPFPALPENEDTQPELYHPMK |
Gene ID - Mouse | ENSMUSG00000031996 |
Gene ID - Rat | ENSRNOG00000047179 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti APLP2 pAb (ATL-HPA039319) | |
Datasheet | Anti APLP2 pAb (ATL-HPA039319) Datasheet (External Link) |
Vendor Page | Anti APLP2 pAb (ATL-HPA039319) at Atlas Antibodies |
Documents & Links for Anti APLP2 pAb (ATL-HPA039319) | |
Datasheet | Anti APLP2 pAb (ATL-HPA039319) Datasheet (External Link) |
Vendor Page | Anti APLP2 pAb (ATL-HPA039319) |
Citations for Anti APLP2 pAb (ATL-HPA039319) – 2 Found |
Jackson, Travis C; Du, Lina; Janesko-Feldman, Keri; Vagni, Vincent A; Dezfulian, Cameron; Poloyac, Samuel M; Jackson, Edwin K; Clark, Robert S B; Kochanek, Patrick M. The nuclear splicing factor RNA binding motif 5 promotes caspase activation in human neuronal cells, and increases after traumatic brain injury in mice. Journal Of Cerebral Blood Flow And Metabolism : Official Journal Of The International Society Of Cerebral Blood Flow And Metabolism. 2015;35(4):655-66. PubMed |
Long, Nguyen Phuoc; Jung, Kyung Hee; Anh, Nguyen Hoang; Yan, Hong Hua; Nghi, Tran Diem; Park, Seongoh; Yoon, Sang Jun; Min, Jung Eun; Kim, Hyung Min; Lim, Joo Han; Kim, Joon Mee; Lim, Johan; Lee, Sanghyuk; Hong, Soon-Sun; Kwon, Sung Won. An Integrative Data Mining and Omics-Based Translational Model for the Identification and Validation of Oncogenic Biomarkers of Pancreatic Cancer. Cancers. 2019;11(2) PubMed |