Anti APLF pAb (ATL-HPA034642)

Atlas Antibodies

SKU: ATL-HPA034642-25

• 
• 

Protein Description: aprataxin and PNKP like factor
Gene Name: APLF
Alternative Gene Name: C2orf13, MGC47799, Xip1, ZCCHH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030051: 52%, ENSRNOG00000043059: 48%
Entrez Gene ID: 200558
Uniprot ID: Q8IW19
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SQLEGSTEIAKTQMTPTNSVSFLGENRDCNKQQPILAERKRILPTWMLAEHLSDQNLSVPAISGGNVIQGSGKEEICKDKSQLN
• Gene Sequence: SQLEGSTEIAKTQMTPTNSVSFLGENRDCNKQQPILAERKRILPTWMLAEHLSDQNLSVPAISGGNVIQGSGKEEICKDKSQLN
• Gene ID - Mouse: ENSMUSG00000030051
• Gene ID - Rat: ENSRNOG00000043059
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.