Anti APLF pAb (ATL-HPA029396)

Atlas Antibodies

Catalog No.: ATL-HPA029396-25

Protein Description: aprataxin and PNKP like factor
Gene Name: APLF
Alternative Gene Name: C2orf13, MGC47799, Xip1, ZCCHH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049409: 63%, ENSRNOG00000009556: 59%
Entrez Gene ID: 200558
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GFMDDNATNTSTSFLSVLNPHGAHATSFPFNFSYSDYDMPLDEDEDVTNSRTFF
• Gene Sequence: GFMDDNATNTSTSFLSVLNPHGAHATSFPFNFSYSDYDMPLDEDEDVTNSRTFF
• Gene ID - Mouse: ENSMUSG00000049409
• Gene ID - Rat: ENSRNOG00000009556
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti APLF pAb (ATL-HPA029396) – 1 Found

Morales, Angélica; Morimoto, Sumiko; Vilchis, Felipe; Taniyama, Natsuko; Bautista, Claudia J; Robles, Carlos; Bargalló, Enrique. Molecular expression of vascular endothelial growth factor, prokineticin receptor-1 and other biomarkers in infiltrating canalicular carcinoma of the breast. Oncology Letters. 2016;12(4):2720-2727.