Anti APLF pAb (ATL-HPA029396)
Atlas Antibodies
- Catalog No.:
- ATL-HPA029396-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: APLF
Alternative Gene Name: C2orf13, MGC47799, Xip1, ZCCHH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049409: 63%, ENSRNOG00000009556: 59%
Entrez Gene ID: 200558
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GFMDDNATNTSTSFLSVLNPHGAHATSFPFNFSYSDYDMPLDEDEDVTNSRTFF |
Gene Sequence | GFMDDNATNTSTSFLSVLNPHGAHATSFPFNFSYSDYDMPLDEDEDVTNSRTFF |
Gene ID - Mouse | ENSMUSG00000049409 |
Gene ID - Rat | ENSRNOG00000009556 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti APLF pAb (ATL-HPA029396) | |
Datasheet | Anti APLF pAb (ATL-HPA029396) Datasheet (External Link) |
Vendor Page | Anti APLF pAb (ATL-HPA029396) at Atlas Antibodies |
Documents & Links for Anti APLF pAb (ATL-HPA029396) | |
Datasheet | Anti APLF pAb (ATL-HPA029396) Datasheet (External Link) |
Vendor Page | Anti APLF pAb (ATL-HPA029396) |
Citations for Anti APLF pAb (ATL-HPA029396) – 1 Found |
Morales, Angélica; Morimoto, Sumiko; Vilchis, Felipe; Taniyama, Natsuko; Bautista, Claudia J; Robles, Carlos; Bargalló, Enrique. Molecular expression of vascular endothelial growth factor, prokineticin receptor-1 and other biomarkers in infiltrating canalicular carcinoma of the breast. Oncology Letters. 2016;12(4):2720-2727. PubMed |