Anti APLF pAb (ATL-HPA029396)

Atlas Antibodies

Catalog No.:
ATL-HPA029396-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: aprataxin and PNKP like factor
Gene Name: APLF
Alternative Gene Name: C2orf13, MGC47799, Xip1, ZCCHH1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049409: 63%, ENSRNOG00000009556: 59%
Entrez Gene ID: 200558
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GFMDDNATNTSTSFLSVLNPHGAHATSFPFNFSYSDYDMPLDEDEDVTNSRTFF
Gene Sequence GFMDDNATNTSTSFLSVLNPHGAHATSFPFNFSYSDYDMPLDEDEDVTNSRTFF
Gene ID - Mouse ENSMUSG00000049409
Gene ID - Rat ENSRNOG00000009556
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti APLF pAb (ATL-HPA029396)
Datasheet Anti APLF pAb (ATL-HPA029396) Datasheet (External Link)
Vendor Page Anti APLF pAb (ATL-HPA029396) at Atlas Antibodies

Documents & Links for Anti APLF pAb (ATL-HPA029396)
Datasheet Anti APLF pAb (ATL-HPA029396) Datasheet (External Link)
Vendor Page Anti APLF pAb (ATL-HPA029396)
Citations for Anti APLF pAb (ATL-HPA029396) – 1 Found
Morales, Angélica; Morimoto, Sumiko; Vilchis, Felipe; Taniyama, Natsuko; Bautista, Claudia J; Robles, Carlos; Bargalló, Enrique. Molecular expression of vascular endothelial growth factor, prokineticin receptor-1 and other biomarkers in infiltrating canalicular carcinoma of the breast. Oncology Letters. 2016;12(4):2720-2727.  PubMed