Anti API5 pAb (ATL-HPA026598)

Atlas Antibodies

SKU:
ATL-HPA026598-25
  • Immunohistochemical staining of human urinary bladder shows strong nuclear positivity in urothelial cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear speckles.
  • Western blot analysis in human cell line NTERA-2.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: apoptosis inhibitor 5
Gene Name: API5
Alternative Gene Name: AAC-11, AAC11, API5L1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027193: 100%, ENSRNOG00000009689: 100%
Entrez Gene ID: 8539
Uniprot ID: Q9BZZ5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen TVEELYRNYGILADATEQVGQHKDAYQVILDGVKGGTKEKRLAAQFIPKFFKHFPELADSAINAQLDLCEDEDVSIRRQAIKELPQFATGENLPRVADILTQLLQTDDSAEFNLVN
Gene Sequence TVEELYRNYGILADATEQVGQHKDAYQVILDGVKGGTKEKRLAAQFIPKFFKHFPELADSAINAQLDLCEDEDVSIRRQAIKELPQFATGENLPRVADILTQLLQTDDSAEFNLVN
Gene ID - Mouse ENSMUSG00000027193
Gene ID - Rat ENSRNOG00000009689
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti API5 pAb (ATL-HPA026598)
Datasheet Anti API5 pAb (ATL-HPA026598) Datasheet (External Link)
Vendor Page Anti API5 pAb (ATL-HPA026598) at Atlas Antibodies

Documents & Links for Anti API5 pAb (ATL-HPA026598)
Datasheet Anti API5 pAb (ATL-HPA026598) Datasheet (External Link)
Vendor Page Anti API5 pAb (ATL-HPA026598)