Anti APEX1 pAb (ATL-HPA002564 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA002564-25
  • Immunohistochemistry analysis in human endometrium and skeletal muscle tissues using Anti-APEX1 antibody. Corresponding APEX1 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus.
  • Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human cell line A-431<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: APEX nuclease (multifunctional DNA repair enzyme) 1
Gene Name: APEX1
Alternative Gene Name: APE, APE-1, APEN, APEX, APX, HAP1, REF-1, REF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035960: 97%, ENSRNOG00000009663: 96%
Entrez Gene ID: 328
Uniprot ID: P27695
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen KLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLAD
Gene Sequence KLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLAD
Gene ID - Mouse ENSMUSG00000035960
Gene ID - Rat ENSRNOG00000009663
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti APEX1 pAb (ATL-HPA002564 w/enhanced validation)
Datasheet Anti APEX1 pAb (ATL-HPA002564 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti APEX1 pAb (ATL-HPA002564 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti APEX1 pAb (ATL-HPA002564 w/enhanced validation)
Datasheet Anti APEX1 pAb (ATL-HPA002564 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti APEX1 pAb (ATL-HPA002564 w/enhanced validation)