Anti APEX1 pAb (ATL-HPA000956)

Atlas Antibodies

SKU:
ATL-HPA000956-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus.
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: APEX nuclease (multifunctional DNA repair enzyme) 1
Gene Name: APEX1
Alternative Gene Name: APE, APE-1, APEN, APEX, APX, HAP1, REF-1, REF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035960: 94%, ENSRNOG00000009663: 93%
Entrez Gene ID: 328
Uniprot ID: P27695
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DKEGYSGVGLLSRQCPLKVSYGIGEEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQEGAPHR
Gene Sequence DKEGYSGVGLLSRQCPLKVSYGIGEEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQEGAPHR
Gene ID - Mouse ENSMUSG00000035960
Gene ID - Rat ENSRNOG00000009663
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti APEX1 pAb (ATL-HPA000956)
Datasheet Anti APEX1 pAb (ATL-HPA000956) Datasheet (External Link)
Vendor Page Anti APEX1 pAb (ATL-HPA000956) at Atlas Antibodies

Documents & Links for Anti APEX1 pAb (ATL-HPA000956)
Datasheet Anti APEX1 pAb (ATL-HPA000956) Datasheet (External Link)
Vendor Page Anti APEX1 pAb (ATL-HPA000956)