Anti APEX1 pAb (ATL-HPA000956)

Atlas Antibodies

SKU: ATL-HPA000956-25

• 

Protein Description: APEX nuclease (multifunctional DNA repair enzyme) 1
Gene Name: APEX1
Alternative Gene Name: APE, APE-1, APEN, APEX, APX, HAP1, REF-1, REF1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035960: 94%, ENSRNOG00000009663: 93%
Entrez Gene ID: 328
Uniprot ID: P27695
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DKEGYSGVGLLSRQCPLKVSYGIGEEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQEGAPHR
• Gene Sequence: DKEGYSGVGLLSRQCPLKVSYGIGEEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQEGAPHR
• Gene ID - Mouse: ENSMUSG00000035960
• Gene ID - Rat: ENSRNOG00000009663
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.