Anti APEH pAb (ATL-HPA029703)

Atlas Antibodies

Catalog No.:
ATL-HPA029703-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: acylaminoacyl-peptide hydrolase
Gene Name: APEH
Alternative Gene Name: D3F15S2, D3S48E, DNF15S2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032590: 86%, ENSRNOG00000029572: 88%
Entrez Gene ID: 327
Uniprot ID: P13798
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EAGFPFSSDCLPDLSVWAEMLDKSPIRYIPQVKTPLLLMLGQEDRRVPFKQGMEYYRALKTRNVPVRLLLYPKSTHALSEVEVESDSFMNAVL
Gene Sequence EAGFPFSSDCLPDLSVWAEMLDKSPIRYIPQVKTPLLLMLGQEDRRVPFKQGMEYYRALKTRNVPVRLLLYPKSTHALSEVEVESDSFMNAVL
Gene ID - Mouse ENSMUSG00000032590
Gene ID - Rat ENSRNOG00000029572
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti APEH pAb (ATL-HPA029703)
Datasheet Anti APEH pAb (ATL-HPA029703) Datasheet (External Link)
Vendor Page Anti APEH pAb (ATL-HPA029703) at Atlas Antibodies

Documents & Links for Anti APEH pAb (ATL-HPA029703)
Datasheet Anti APEH pAb (ATL-HPA029703) Datasheet (External Link)
Vendor Page Anti APEH pAb (ATL-HPA029703)