Anti APEH pAb (ATL-HPA029703)
Atlas Antibodies
- Catalog No.:
- ATL-HPA029703-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: APEH
Alternative Gene Name: D3F15S2, D3S48E, DNF15S2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032590: 86%, ENSRNOG00000029572: 88%
Entrez Gene ID: 327
Uniprot ID: P13798
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EAGFPFSSDCLPDLSVWAEMLDKSPIRYIPQVKTPLLLMLGQEDRRVPFKQGMEYYRALKTRNVPVRLLLYPKSTHALSEVEVESDSFMNAVL |
| Gene Sequence | EAGFPFSSDCLPDLSVWAEMLDKSPIRYIPQVKTPLLLMLGQEDRRVPFKQGMEYYRALKTRNVPVRLLLYPKSTHALSEVEVESDSFMNAVL |
| Gene ID - Mouse | ENSMUSG00000032590 |
| Gene ID - Rat | ENSRNOG00000029572 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti APEH pAb (ATL-HPA029703) | |
| Datasheet | Anti APEH pAb (ATL-HPA029703) Datasheet (External Link) |
| Vendor Page | Anti APEH pAb (ATL-HPA029703) at Atlas Antibodies |
| Documents & Links for Anti APEH pAb (ATL-HPA029703) | |
| Datasheet | Anti APEH pAb (ATL-HPA029703) Datasheet (External Link) |
| Vendor Page | Anti APEH pAb (ATL-HPA029703) |